RegulonDB RegulonDB 10.9: Gene Form
   

gcvA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gcvA ygdD gcvB rlmM GcvA GcvA TSS_3119 TSS_3119 TSS_3118 TSS_3118 gcvBp gcvBp gcvAp gcvAp ygdDp2 ygdDp2

Gene      
Name: gcvA    Texpresso search in the literature
Synonym(s): ECK2803, EG11795, b2808
Genome position(nucleotides): 2941650 <-- 2942567 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.13
External database links:  
ASAP:
ABE-0009202
CGSC:
28676
ECHOBASE:
EB1743
ECOLIHUB:
gcvA
OU-MICROARRAY:
b2808
STRING:
511145.b2808
COLOMBOS: gcvA


Shine dalgarno      
Sequence: catttaacatCAAAGTttaatagcCAT


Product      
Name: DNA-binding transcriptional dual regulator GcvA
Synonym(s): GcvA, positive regulator of gcv operon
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 34.402
Isoelectric point: 9.311
Motif(s):
 
Type Positions Sequence
6 -> 63 PPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSLLLT
8 -> 67 LNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGLKLFRRRNRSLLLTEEGQ
23 -> 42 FTRAAEELFVTQAAVSHQIK
91 -> 292 SAKGALTVSLLPSFAIHWLVPRLSSFNSAYPGIDVRIQAVDRQEDKLADDVDVAIFYGRGNWPGLRVEKLYAEYLLPVCSPLLLTGEKPLKTPEDLAKHTLLHDASRRDWQTYTRQLGLNHINVQQGPIFSHSAMVLQAAIHGQGVALANNVMAQSEIEAGRLVCPFNDVLVSKNAFYLVCHDSQAELGKIAAFRQWILAKA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.17 - formyl-THF biosynthesis
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0009411 - response to UV
Note(s): Note(s): ...[more].
Evidence: [BPP] Binding of purified proteins
[GEA] Gene expression analysis
[HIFS] Human inference of function from sequence
Reference(s): [1] Okamura-Ikeda K., et al., 1993
[2] Sargentini NJ., et al., 2016
[3] Wilson RL., et al., 1994
[4] Wilson RL., et al., 1995
External database links:  
DIP:
DIP-9751N
ECOCYC:
PD00339
ECOLIWIKI:
b2808
INTERPRO:
IPR000847
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR005119
MODBASE:
P0A9F6
PFAM:
PF03466
PFAM:
PF00126
PRIDE:
P0A9F6
PRINTS:
PR00039
PRODB:
PRO_000022762
PROSITE:
PS50931
REFSEQ:
NP_417288
SMR:
P0A9F6
UNIPROT:
P0A9F6


Operon      
Name: gcvA         
Operon arrangement:
Transcription unit        Promoter
gcvA


Transcriptional Regulation      
Display Regulation             
Repressed by: GcvA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ygdDp2 2941721 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_3118 2942729 forward nd [RS-EPT-CBR] [6]
  promoter TSS_3119 2942760 forward nd [RS-EPT-CBR] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Okamura-Ikeda K., Ohmura Y., Fujiwara K., Motokawa Y., 1993, Cloning and nucleotide sequence of the gcv operon encoding the Escherichia coli glycine-cleavage system., Eur J Biochem 216(2):539-48

 [2] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [3] Wilson RL., Stauffer GV., 1994, DNA sequence and characterization of GcvA, a LysR family regulatory protein for the Escherichia coli glycine cleavage enzyme system., J Bacteriol 176(10):2862-8

 [4] Wilson RL., Urbanowski ML., Stauffer GV., 1995, DNA binding sites of the LysR-type regulator GcvA in the gcv and gcvA control regions of Escherichia coli., J Bacteriol 177(17):4940-6

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB