RegulonDB RegulonDB 10.8: Gene Form
   

talA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: talA    Texpresso search in the literature
Synonym(s): ECK2459, EG11797, b2464
Genome position(nucleotides): 2578666 --> 2579616 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.26
External database links:  
ASAP:
ABE-0008115
ECHOBASE:
EB1745
OU-MICROARRAY:
b2464
PortEco:
talA
STRING:
511145.b2464
COLOMBOS: talA


Product      
Name: transaldolase A
Synonym(s): TalA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.659
Isoelectric point: 6.186
Motif(s):
 
Type Positions Sequence
13 -> 310 VVADSGDIESIRHYHPQDATTNPSLLLKAAGLSQYEHLIDDAIAWGKKNGKTQEQQVVAACDKLAVNFGAEILKIVPGRVSTEVDARLSFDKEKSIEKARHLVDLYQQQGVEKSRILIKLASTWEGIRAAEELEKEGINCNLTLLFSFAQARACAEAGVFLISPFVGRIYDWYQARKPMDPYVVEEDPGVKSVRNIYDYYKQHHYETIVMGASFRRTEQILALTGCDRLTIAPNLLKELQEKVSPVVRKLIPPSQTFPRPAPMSEAEFRWEHNQDAMAVEKLSEGIRLFAVDQRKLED

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.3 - non-oxidative branch, pentose pathway
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0004801 - sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006098 - pentose-phosphate shunt
Note(s): Note(s): ...[more].
Reference(s): [1] Gu Y., et al., 2009
[2] Song BG., et al., 2006
[3] Tao H., et al., 2001
External database links:  
DIP:
DIP-47872N
ECOCYC:
TRANSALDOLA-MONOMER
ECOLIWIKI:
b2464
INTERPRO:
IPR001585
INTERPRO:
IPR018225
INTERPRO:
IPR013785
INTERPRO:
IPR004730
MODBASE:
P0A867
PANTHER:
PTHR10683
PFAM:
PF00923
PRIDE:
P0A867
PRODB:
PRO_000024022
PROSITE:
PS01054
PROSITE:
PS00958
REFSEQ:
NP_416959
SMR:
P0A867
SWISSMODEL:
P0A867
UNIPROT:
P0A867


Operon      
Name: talA-tktB         
Operon arrangement:
Transcription unit        Promoter
talA-tktB
talA-tktB
talA
tktB


Transcriptional Regulation      
Display Regulation             
Activated by: CreB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2749 2578531 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2750 2578793 reverse nd [RS-EPT-CBR] [4]



RegulonDB