RegulonDB RegulonDB 10.8: Gene Form
   

yebF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yebE yebF yebG CpxR purTp5 purTp5 TSS_2189 (cluster) TSS_2189 (cluster) TSS_2188 TSS_2188 yebEp yebEp

Gene      
Name: yebF    Texpresso search in the literature
Synonym(s): ECK1848, EG11807, b1847
Genome position(nucleotides): 1930034 <-- 1930390 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.3
External database links:  
ASAP:
ABE-0006141
ECHOBASE:
EB1755
OU-MICROARRAY:
b1847
PortEco:
yebF
STRING:
511145.b1847
COLOMBOS: yebF


Product      
Name: secreted protein YebF
Synonym(s): YebF
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,extracellular space
Molecular weight: 12.962
Isoelectric point: 8.858
Motif(s):
 
Type Positions Sequence
28 -> 116 KSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQ
1 -> 21 MKKRGAFLGLLLVSACASVFA
22 -> 118 ANNETSKSVTFPKCEDLDAAGIAASVKRDYQQNRVARWADDQKIVGQADPVAWVSLQDIQGKDDKWSVPLTVRGKSADIHYQVSVDCKAGMAEYQRR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0005576 - extracellular region
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
EG11807-MONOMER
ECOLIWIKI:
b1847
INTERPRO:
IPR025603
INTERPRO:
IPR020236
INTERPRO:
IPR038703
PDB:
2LQV
PFAM:
PF13995
PRIDE:
P33219
PRODOM:
PD077599
REFSEQ:
NP_416361
SMR:
P33219
UNIPROT:
P33219


Operon      
Name: yebF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2188 1929734 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2189 (cluster) 1930416 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter purTp5 1930719 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB