RegulonDB RegulonDB 10.9: Gene Form
   

purU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purU ychJ tyrT Fis Fis Fis ppGpp rssAp rssAp purUp4 purUp4 purUp5 purUp5 purUp3 purUp3 TSS_1557 TSS_1557 TSS_1556 TSS_1556 tyrTp tyrTp

Gene      
Name: purU    Texpresso search in the literature
Synonym(s): ECK1227, EG11819, b1232, tgs, ychI
Genome position(nucleotides): 1287782 <-- 1288624 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.21
External database links:  
ASAP:
ABE-0004138
CGSC:
35231
ECHOBASE:
EB1766
ECOLIHUB:
purU
NCBI-GENE:
945827
OU-MICROARRAY:
b1232
STRING:
511145.b1232
COLOMBOS: purU


Product      
Name: formyltetrahydrofolate deformylase
Synonym(s): PurU, Tgs, YchI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.935
Isoelectric point: 7.0
Motif(s):
 
Type Positions Sequence
8 -> 86 VLRTICPDQKGLIARITNICYKHELNIVQNNEFVDHRTGRFFMRTELEGIFNDSTLLADLDSALPEGSVRELNPAGRRR
86 -> 262 RIVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHDTLRSLVERFDIPFELVSHEGLTRNEHDQKMADAIDAYQPDYVVLAKYMRVLTPEFVARFPNKIINIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTAEDMMRAGRDVEKNVLSRAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.3 - purine ribonucleotide biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.17 - formyl-THF biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016742 - hydroxymethyl-, formyl- and related transferase activity
GO:0008864 - formyltetrahydrofolate deformylase activity
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0006730 - one-carbon metabolic process
GO:0009058 - biosynthetic process
GO:0009152 - purine ribonucleotide biosynthetic process
GO:0009257 - 10-formyltetrahydrofolate biosynthetic process
GO:0006189 - 'de novo' IMP biosynthetic process
External database links:  
ECOCYC:
FORMYLTHFDEFORMYL-MONOMER
ECOLIWIKI:
b1232
INTERPRO:
IPR041729
INTERPRO:
IPR036477
INTERPRO:
IPR002376
INTERPRO:
IPR002912
INTERPRO:
IPR004810
MODBASE:
P37051
PANTHER:
PTHR42706
PFAM:
PF00551
PFAM:
PF01842
PRIDE:
P37051
PRINTS:
PR01575
PRODB:
PRO_000023646
PROSITE:
PS51671
REFSEQ:
NP_415748
SMR:
P37051
UNIPROT:
P37051


Operon      
Name: purU         
Operon arrangement:
Transcription unit        Promoter
purU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1556 1288063 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1557 1288077 reverse nd [RS-EPT-CBR] [1]
  promoter purUp3 1288751 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter purUp5 1288753 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter purUp4 1288756 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB