RegulonDB RegulonDB 10.9: Gene Form
   

yceI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

trhO yceI yceJ yceIp5 yceIp5

Gene      
Name: yceI    Texpresso search in the literature
Synonym(s): ECK1041, EG11820, b1056
Genome position(nucleotides): 1117901 <-- 1118476 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.4
External database links:  
ASAP:
ABE-0003583
ECHOBASE:
EB1767
ECOLIHUB:
yceI
OU-MICROARRAY:
b1056
STRING:
511145.b1056
COLOMBOS: yceI


Product      
Name: protein YceI
Synonym(s): YceI
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 20.912
Isoelectric point: 5.677
Motif(s):
 
Type Positions Sequence
25 -> 186 YKIDKEGQHAFVNFRIQHLGYSWLYGTFKDFDGTFTFDEKNPAADKVNVTINTTSVDTNHAERDKHLRSADFLNTAKYPQATFTSTSVKKDGDELDITGDLTLNGVTKPVTLEAKLIGQGDDPWGGKRAGFEAEGKIKLKDFNIKTDLGPASQEVDLIISVE
1 -> 22 MKKSLLGLTFASLMFSAGSAVA
23 -> 191 ADYKIDKEGQHAFVNFRIQHLGYSWLYGTFKDFDGTFTFDEKNPAADKVNVTINTTSVDTNHAERDKHLRSADFLNTAKYPQATFTSTSVKKDGDELDITGDLTLNGVTKPVTLEAKLIGQGDDPWGGKRAGFEAEGKIKLKDFNIKTDLGPASQEVDLIISVEGVQQK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11820-MONOMER
ECOLIWIKI:
b1056
INTERPRO:
IPR007372
INTERPRO:
IPR023480
INTERPRO:
IPR036761
MODBASE:
P0A8X2
PDB:
1Y0G
PFAM:
PF04264
PRIDE:
P0A8X2
REFSEQ:
NP_415574
SMART:
SM00867
SMR:
P0A8X2
UNIPROT:
P0A8X2


Operon      
Name: yceJI         
Operon arrangement:
Transcription unit        Promoter
yceJI
yceJI
yceI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yceIp5 1118641 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB