RegulonDB RegulonDB 10.8: Gene Form
   

etk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

etk appA etp gfcE etkp1 etkp1

Gene      
Name: etk    Texpresso search in the literature
Synonym(s): ECK0972, EG11826, b0981, yccC
Genome position(nucleotides): 1042030 <-- 1044210 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.53
External database links:  
ASAP:
ABE-0003309
ECHOBASE:
EB1773
OU-MICROARRAY:
b0981
PortEco:
etk
STRING:
511145.b0981
COLOMBOS: etk


Product      
Name: protein-tyrosine kinase Etk
Synonym(s): Etk, YccC, autophosphorylating protein tyrosine kinase
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 81.242
Isoelectric point: 6.62
Motif(s):
 
Type Positions Sequence
16 -> 107 NEIDLLRLVGELWDHRKFIISVTALFTLIAVAYSLLSTPIYQADTLVQVEQKQGNAILSGLSDMIPNSSPESAPEIQLLQSRMILGKTIAEL
367 -> 448 STQQEVLRLSRDVEAGRAVYLQLLNRQQELSISKSSAIGNVRIIDPAVTQPQPVKPKKALNVVLGFILGLFISVGAVLARAM
425 -> 445 ALNVVLGFILGLFISVGAVLA
726 -> 726 E
543 -> 654 SGKTFVSSTLAAVIAQSDQKVLFIDADLRRGYSHNLFTVSNEHGLSEYLAGKDELNKVIQHFGKGGFDVITRGQVPPNPSELLMRDRMRQLLEWANDHYDLVIVDTPPMLAV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0004713 - protein tyrosine kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0042802 - identical protein binding
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
GO:0016310 - phosphorylation
GO:0045226 - extracellular polysaccharide biosynthetic process
GO:0038083 - peptidyl-tyrosine autophosphorylation
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Ilan O., et al., 1999
External database links:  
DIP:
DIP-9526N
ECOCYC:
EG11826-MONOMER
ECOLIWIKI:
b0981
INTERPRO:
IPR032807
INTERPRO:
IPR027417
INTERPRO:
IPR025669
INTERPRO:
IPR005702
INTERPRO:
IPR003856
MINT:
P38134
MODBASE:
P38134
PDB:
3CIO
PFAM:
PF02706
PFAM:
PF13614
PFAM:
PF13807
PRIDE:
P38134
PRODB:
PRO_000022533
REFSEQ:
NP_415501
SMR:
P38134
UNIPROT:
P38134


Operon      
Name: gfcE-etp-etk         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter etkp1 1044303 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Ilan O., Bloch Y., Frankel G., Ullrich H., Geider K., Rosenshine I., 1999, Protein tyrosine kinases in bacterial pathogens are associated with virulence and production of exopolysaccharide., EMBO J 18(12):3241-8

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB