RegulonDB RegulonDB 10.9: Gene Form
   

srkA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

srkA dsbA yihD CpxR terminator TSS_4532 TSS_4532 TSS_4531 TSS_4531 TSS_4530 (cluster) TSS_4530 (cluster) dsbAp dsbAp TSS_4528 TSS_4528 TSS_4527 TSS_4527 srkAp srkAp mobAp2 mobAp2

Gene      
Name: srkA    Texpresso search in the literature
Synonym(s): ECK3851, EG11831, b3859, orfA, yihE
Genome position(nucleotides): 4042415 --> 4043401 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.63
External database links:  
ASAP:
ABE-0012604
ECHOBASE:
EB1778
ECOLIHUB:
rdoA
OU-MICROARRAY:
b3859
STRING:
511145.b3859
COLOMBOS: srkA


Product      
Name: stress response kinase A
Synonym(s): OrfA, SrkA, YihE, serine/threonine protein kinase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 38.12
Isoelectric point: 4.762
Motif(s):
 
Type Positions Sequence
32 -> 259 TPLNSYENRVYQFQDEDRRRFVVKFYRPERWTADQILEEHQFALQLVNDEVPVAAPVAFNGQTLLNHQGFYFAVFPSVGGRQFEADNIDQMEAVGRYLGRMHQTGRKQLFIHRPTIGLNEYLIEPRKLFEDATLIPSGLKAAFLKATDELIAAVTAHWREDFTVLRLHGDCHAGNILWRDGPMFVDLDDARNGPAVQDLWMLLNGDKAEQRMQLETIIEAYEEFSEFD
217 -> 217 D
36 -> 36 S

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0106311 - protein threonine kinase activity
GO:0106310 - protein serine kinase activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0004674 - protein serine/threonine kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000287 - magnesium ion binding
biological_process GO:0006950 - response to stress
GO:0006468 - protein phosphorylation
GO:0016310 - phosphorylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11831-MONOMER
ECOLIWIKI:
b3859
INTERPRO:
IPR011009
INTERPRO:
IPR032882
INTERPRO:
IPR002575
MODBASE:
P0C0K3
PANTHER:
PTHR39573
PDB:
1ZYL
PFAM:
PF01636
PRIDE:
P0C0K3
PRODB:
PRO_000023695
REFSEQ:
NP_418296
SMR:
P0C0K3
UNIPROT:
P0C0K3


Operon      
Name: srkA-dsbA         
Operon arrangement:
Transcription unit        Promoter
srkA-dsbA
dsbA


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4527 4042399 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4528 4043252 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4530 (cluster) 4043383 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4531 4043393 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4532 4043397 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB