RegulonDB RegulonDB 10.9: Gene Form
   

yihT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yihS yihU yihT yihVp6 yihVp6

Gene      
Name: yihT    Texpresso search in the literature
Synonym(s): ECK3874, EG11846, b3881, squT
Genome position(nucleotides): 4071773 <-- 4072651 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.81
External database links:  
ASAP:
ABE-0012675
ECHOBASE:
EB1792
ECOLIHUB:
yihT
OU-MICROARRAY:
b3881
STRING:
511145.b3881
COLOMBOS: yihT


Product      
Name: 6-deoxy-6-sulfofructose-1-phosphate aldolase
Synonym(s): SquT, YihT
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.983
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
17 -> 257 AMLAVDQREAMRMMFAAAGAPAPVADSVLTDFKVNAAKALSPYASAILVDQQFCYRQVVEQNAIAKSCAMIVAADEFIPGNGIPVDSVVIDRKINPLQIKQDGGKALKLLVLWRSDEDAQQRLDMVKEFNELCHSHGLVSIIEPVVRPPRRGDKFDREQAIIDAAKELGDSGADLYKVEMPLYGKGPQQELLCASQRLNDHINMPWVILSSGVDEKLFPRAVRVAMTAGASGFLAGRAVWA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0061595 - 6-deoxy-6-sulfofructose-1-phosphate aldolase activity
biological_process GO:1902777 - 6-sulfoquinovose(1-) catabolic process
GO:0061720 - 6-sulfoquinovose(1-) catabolic process to glycerone phosphate and 3-sulfolactaldehyde
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11846-MONOMER
ECOLIWIKI:
b3881
INTERPRO:
IPR013785
INTERPRO:
IPR017291
INTERPRO:
IPR002915
MODBASE:
P32141
PFAM:
PF01791
PRIDE:
P32141
REFSEQ:
NP_418317
SMART:
SM01133
SMR:
P32141
SWISSMODEL:
P32141
UNIPROT:
P32141


Operon      
Name: yihUTS         
Operon arrangement:
Transcription unit        Promoter
yihUTS
yihUTS
yihUTS
yihUTS
yihUTS


Transcriptional Regulation      
Display Regulation             
Repressed by: CsqR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yihVp6 4073532 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB