RegulonDB RegulonDB 11.0: Gene Form
   

rhaD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhaA rhaD rhaM rhaB rhaDp rhaDp

Gene      
Name: rhaD    Texpresso search in the literature
Synonym(s): ECK3895, EG11866, b3902
Genome position(nucleotides): 4093448 <-- 4094272
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.76
External database links:  
ASAP:
ABE-0012731
CGSC:
289
ECHOBASE:
EB1812
ECOLIHUB:
rhaD
OU-MICROARRAY:
b3902
STRING:
511145.b3902
COLOMBOS: rhaD


Product      
Name: rhamnulose-1-phosphate aldolase
Synonym(s): RhaD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.145
Isoelectric point: 5.779
Motif(s):
 
Type Positions Sequence Comment
12 -> 238 GMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQPMPLLANTPFIVTGSGKFFRNVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPAHFLSHCERIKATNGKDRVIMHCHATNLIALTYVLENDTAVFTRQLWEGSTECLVVFPDGVGILPWMVPGTDEIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVL
28 -> 28 R UniProt: Severe loss of enzymatic activity..
29 -> 29 N UniProt: Severe loss of enzymatic activity..
117 -> 117 E UniProt: Loss of enzymatic activity..
171 -> 171 E UniProt: Loss of enzymatic activity..

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016832 - aldehyde-lyase activity
GO:0008270 - zinc ion binding
GO:0008994 - rhamnulose-1-phosphate aldolase activity
GO:0042802 - identical protein binding
biological_process GO:0019299 - rhamnose metabolic process
GO:0019301 - rhamnose catabolic process
GO:0019323 - pentose catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Calveras J., et al., 2009
[2] Jimenez A., et al., 2009
External database links:  
ALPHAFOLD:
P32169
ECOCYC:
RHAMNULPALDOL-MONOMER
ECOLIWIKI:
B3902
INTERPRO:
IPR013447
INTERPRO:
IPR036409
INTERPRO:
IPR001303
MODBASE:
P32169
PDB:
1GT7
PDB:
2V9O
PDB:
2V9N
PDB:
2V9M
PDB:
2V9L
PDB:
2V9I
PDB:
2V9G
PDB:
1OJR
PDB:
2UYU
PDB:
2UYV
PDB:
2V29
PDB:
2V2A
PDB:
2V2B
PDB:
2V9E
PDB:
2V9F
PFAM:
PF00596
PRIDE:
P32169
PRODB:
PRO_000023735
REFSEQ:
NP_418338
SMART:
SM01007
SMR:
P32169
UNIPROT:
P32169


Operon      
Name: rhaBAD         
Operon arrangement:
Transcription unit        Promoter
rhaD
rhaBAD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, RhaS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Calveras J., Egido-Gabas M., Gomez L., Casas J., Parella T., Joglar J., Bujons J., Clapes P., 2009, Dihydroxyacetone phosphate aldolase catalyzed synthesis of structurally diverse polyhydroxylated pyrrolidine derivatives and evaluation of their glycosidase inhibitory properties., Chemistry 15(30):7310-28

 [2] Jimenez A., Clapes P., Crehuet R., 2009, Protein flexibility and metal coordination changes in DHAP-dependent aldolases., Chemistry 15(6):1422-8


RegulonDB