RegulonDB RegulonDB 10.8: Gene Form
   

trxC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfiF tapT trxC CRP CRP OxyR OxyR terminator terminator TSS_2892 TSS_2892 trxCp trxCp TSS_2891 TSS_2891 TSS_2890 (cluster) TSS_2890 (cluster)

Gene      
Name: trxC    Texpresso search in the literature
Synonym(s): ECK2580, EG11887, b2582, yfiG
Genome position(nucleotides): 2718735 --> 2719154 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.52
Reference(s): [1] Miranda-Vizuete A., et al., 1997
External database links:  
ASAP:
ABE-0008501
ECHOBASE:
EB1833
OU-MICROARRAY:
b2582
PortEco:
trxC
STRING:
511145.b2582
COLOMBOS: trxC


Product      
Name: reduced thioredoxin 2
Synonym(s): Trx2, TrxC, YfiG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.555
Isoelectric point: 4.774
Motif(s):
 
Type Positions Sequence
37 -> 136 VINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNTEAERELSSRFGIRSIPTIMIFKNGQVVDMLNGAVPKAPFDSWLN
26 -> 139 GRCGHDLFDGEVINATGETLDKLLKDDLPVVIDFWAPWCGPCRNFAPIFEDVAQERSGKVRFVKVNTEAERELSSRFGIRSIPTIMIFKNGQVVDMLNGAVPKAPFDSWLNESL
5 -> 18 CTHCQAINRIPDDR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.2 - thioredoxin, glutaredoxin
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008270 - zinc ion binding
GO:0016671 - oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
GO:0015035 - protein disulfide oxidoreductase activity
GO:0047134 - protein-disulfide reductase activity
biological_process GO:0006662 - glycerol ether metabolic process
GO:0045454 - cell redox homeostasis
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
DIP:
DIP-48115N
ECOCYC:
RED-THIOREDOXIN2-MONOMER
ECOLIWIKI:
b2582
INTERPRO:
IPR036249
INTERPRO:
IPR017937
INTERPRO:
IPR013766
INTERPRO:
IPR005746
MINT:
MINT-1227521
MODBASE:
P0AGG4
PANTHER:
PTHR10438
PFAM:
PF00085
PRIDE:
P0AGG4
PRINTS:
PR00421
PRODB:
PRO_000024131
PROSITE:
PS51352
PROSITE:
PS00194
REFSEQ:
NP_417077
SMR:
P0AGG4
SWISSMODEL:
P0AGG4
UNIPROT:
P0AGG4


Operon      
Name: trxC         
Operon arrangement:
Transcription unit        Promoter
trxC


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2890 (cluster) 2718554 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2891 2718593 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2892 2718965 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Miranda-Vizuete A., Damdimopoulos AE., Gustafsson J., Spyrou G., 1997, Cloning, expression, and characterization of a novel Escherichia coli thioredoxin., J Biol Chem 272(49):30841-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB