RegulonDB RegulonDB 10.8: Gene Form
   

dctR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhiD slp dctR MarA

Gene      
Name: dctR    Texpresso search in the literature
Synonym(s): ECK3491, EG11889, b3507, yhiF
Genome position(nucleotides): 3654683 --> 3655213 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.74
External database links:  
ASAP:
ABE-0011454
ECHOBASE:
EB1835
OU-MICROARRAY:
b3507
PortEco:
dctR
STRING:
511145.b3507
COLOMBOS: dctR


Product      
Name: putative DNA-binding transcriptional regulator DctR
Synonym(s): DctR, YhiF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.408
Isoelectric point: 8.96
Motif(s):
 
Type Positions Sequence
115 -> 168 SLSRKQHQVLSCIANQMTTEDILEKLKISLKTFYCHKHNIMMILNLKRINELVR
133 -> 152 TEDILEKLKISLKTFYCHKH
163 -> 176 INELVRHQHIDYLV
109 -> 174 VPEAAVSLSRKQHQVLSCIANQMTTEDILEKLKISLKTFYCHKHNIMMILNLKRINELVRHQHIDY

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
  5 - cell processes --> 5.5 - adaptations --> 5.5.4 - pH
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0043471 - regulation of cellular carbohydrate catabolic process
GO:1990451 - cellular stress response to acidic pH
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[HIFS] Human inference of function from sequence
[IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [1] Boogerd FC., et al., 1998
[2] Mates AK., et al., 2007
[3] Perez-Rueda E., et al., 2004
[4] Segev E., et al., 2018
External database links:  
DIP:
DIP-12362N
ECOCYC:
EG11889-MONOMER
ECOLIWIKI:
b3507
INTERPRO:
IPR000792
INTERPRO:
IPR016032
INTERPRO:
IPR036388
MODBASE:
P37195
PFAM:
PF00196
PRIDE:
P37195
PRODB:
PRO_000022411
PROSITE:
PS50043
REFSEQ:
NP_417964
SMART:
SM00421
SMR:
P37195
UNIPROT:
P37195


Operon      
Name: slp-dctR         
Operon arrangement:
Transcription unit        Promoter
slp-dctR


Transcriptional Regulation      
Display Regulation             
Activated by: GadX, GadE-RcsB, YdeO
Repressed by: MarA, H-NS, GadW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Boogerd FC., Boe L., Michelsen O., Jensen PR., 1998, atp Mutants of Escherichia coli fail to grow on succinate due to a transport deficiency., J Bacteriol 180(22):5855-9

 [2] Mates AK., Sayed AK., Foster JW., 2007, Products of the Escherichia coli acid fitness island attenuate metabolite stress at extremely low pH and mediate a cell density-dependent acid resistance., J Bacteriol 189(7):2759-68

 [3] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [4] Segev E., Pasternak Z., Ben Sasson T., Jurkevitch E., Gonen M., 2018, Automatic identification of optimal marker genes for phenotypic and taxonomic groups of microorganisms., PLoS One 13(5):e0195537


RegulonDB