RegulonDB RegulonDB 10.7: Gene Form
   

slp gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insH-11 slp dctR MarA GadX GadX YdeO GadX GadW GadX GadX GadW slpp slpp insHp4 insHp4 insHp3 insHp3 TSS_4112 TSS_4112

Gene      
Name: slp    Texpresso search in the literature
Synonym(s): ECK3490, EG11890, b3506
Genome position(nucleotides): 3653961 --> 3654527 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.86
Reference(s): [1] Alexander DM., et al., 1994
External database links:  
ASAP:
ABE-0011451
CGSC:
33726
ECHOBASE:
EB1836
OU-MICROARRAY:
b3506
PORTECO:
slp
REGULONDB:
b3506
STRING:
511145.b3506
M3D: slp
COLOMBOS: slp
PortEco: b3506


Product      
Name: starvation lipoprotein
Synonym(s): Slp
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 20.964
Isoelectric point: 7.585
Motif(s):
 
Type Positions Sequence
16 -> 165 LAACSSIPQNIKGNNQPDIQKSFVAVHNQPGLYVGQQARFGGKVINVINGKTDTLLEISVLPLDSYAKPDIEANYQGRLLARQSGFLDPVNYRNHFVTILGTIQGEQPGFINKVPYNFLEVNMQGIQVWHLREVVNTTYNLWDYGYGAFW
19 -> 188 CSSIPQNIKGNNQPDIQKSFVAVHNQPGLYVGQQARFGGKVINVINGKTDTLLEISVLPLDSYAKPDIEANYQGRLLARQSGFLDPVNYRNHFVTILGTIQGEQPGFINKVPYNFLEVNMQGIQVWHLREVVNTTYNLWDYGYGAFWPEPGWGAPYYTNAVSQVTPELVK
1 -> 18 MNMTKGALILSLSFLLAA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
molecular_function GO:0042802 - identical protein binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11890-MONOMER
ECOLIWIKI:
b3506
INTERPRO:
IPR004658
PANTHER:
PTHR37530
PFAM:
PF03843
PRIDE:
P37194
PRODB:
PRO_000023955
PROSITE:
PS51257
PROTEINMODELPORTAL:
P37194
REFSEQ:
NP_417963
UNIPROT:
P37194


Operon      
Name: slp-dctR         
Operon arrangement:
Transcription unit        Promoter
slp-dctR


Transcriptional Regulation      
Display Regulation             
Activated by: GadX, GadE-RcsB, YdeO
Repressed by: MarA, H-NS, GadW


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4112 3653189 reverse nd [RS-EPT-CBR] [2]
  promoter insHp3 3653268 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [2], [3]
  promoter insHp4 3653269 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Alexander DM., St John AC., 1994, Characterization of the carbon starvation-inducible and stationary phase-inducible gene slp encoding an outer membrane lipoprotein in Escherichia coli., Mol Microbiol 11(6):1059-71

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB