RegulonDB RegulonDB 10.8: Gene Form
   

yeeA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeeA sbmC yeeX yeeAp6 yeeAp6 TSS_2315 (cluster) TSS_2315 (cluster) yeeXp4 yeeXp4 TSS_2314 TSS_2314 TSS_2313 TSS_2313 TSS_2312 TSS_2312

Gene      
Name: yeeA    Texpresso search in the literature
Synonym(s): ECK2002, EG11891, b2008
Genome position(nucleotides): 2079533 <-- 2080591 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.8
External database links:  
ASAP:
ABE-0006667
ECHOBASE:
EB1837
OU-MICROARRAY:
b2008
PortEco:
yeeA
STRING:
511145.b2008
COLOMBOS: yeeA


Product      
Name: putative transporter YeeA
Synonym(s): YeeA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 39.955
Isoelectric point: 9.78
Motif(s):
 
Type Positions Sequence
26 -> 46 VALAFLLTFLIIRLFTIPEST
21 -> 254 VHGTRVALAFLLTFLIIRLFTIPESTWPLVTMVVIMGPISFWGNVVPRAFERIGGTVLGSILGLIALQLELISLPLMLVWCAAAMFLCGWLALGKKPYQGLLIGVTLAIVVGSPTGEIDTALWRSGDVILGSLLAMLFTGIWPQRAFIHWRIQLAKSLTEYNRVYQSAFSPNLLERPRLESHLQKLLTDAVKMRGLIAPASKETRIPKSIYEGIQTINRNLVCMLELQINAYWA
69 -> 89 AFERIGGTVLGSILGLIALQL
91 -> 111 LISLPLMLVWCAAAMFLCGWL
47 -> 67 WPLVTMVVIMGPISFWGNVVP

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
EG11891-MONOMER
ECOLIWIKI:
b2008
INTERPRO:
IPR006726
PFAM:
PF04632
PRIDE:
P33011
REFSEQ:
NP_416512
UNIPROT:
P33011


Operon      
Name: yeeA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2312 2079341 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2313 2079386 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2314 2079416 reverse nd [RS-EPT-CBR] [2]
  promoter yeeXp4 2079417 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2315 (cluster) 2079469 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter yeeAp6 2080661 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB