RegulonDB RegulonDB 10.8: Gene Form
   

yeeD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sbcB yeeE yeeD TSS_2321 TSS_2321 TSS_2320 TSS_2320 TSS_2319 TSS_2319

Gene      
Name: yeeD    Texpresso search in the literature
Synonym(s): ECK2006, EG11894, b2012
Genome position(nucleotides): 2084226 <-- 2084453 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.44
External database links:  
ASAP:
ABE-0006688
ECHOBASE:
EB1840
OU-MICROARRAY:
b2012
PortEco:
yeeD
STRING:
511145.b2012
COLOMBOS: yeeD


Product      
Name: putative sulfurtransferase YeeD
Synonym(s): YeeD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 8.148
Isoelectric point: 3.923
Motif(s):
 
Type Positions Sequence
4 -> 74 KKLDVVTQVCPFPLIEAKAALAEMVSGDELVIEFDCTQATEAIPQWAAEEGHAITDYQQIGDAAWSITVQK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11894-MONOMER
ECOLIWIKI:
b2012
INTERPRO:
IPR001455
INTERPRO:
IPR036868
MODBASE:
P33014
PFAM:
PF01206
PRIDE:
P33014
PROSITE:
PS01148
REFSEQ:
NP_416516
SMR:
P33014
UNIPROT:
P33014


Operon      
Name: yeeED         
Operon arrangement:
Transcription unit        Promoter
yeeED


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2319 2083283 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2320 2084549 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2321 2085498 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB