RegulonDB RegulonDB 10.8: Gene Form
   

yeeE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

plaP yeeE yeeD yoeI anti-anti-terminator anti-terminator terminator yeeEp yeeEp TSS_2321 TSS_2321 TSS_2320 TSS_2320

Gene      
Name: yeeE    Texpresso search in the literature
Synonym(s): ECK2007, EG11895, b2013
Genome position(nucleotides): 2084467 <-- 2085525 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.42
External database links:  
ASAP:
ABE-0006691
ECHOBASE:
EB1841
OU-MICROARRAY:
b2013
PortEco:
yeeE
STRING:
511145.b2013
COLOMBOS: yeeE


Product      
Name: inner membrane protein YeeE
Synonym(s): YeeE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 38.1
Isoelectric point: 10.613
Motif(s):
 
Type Positions Sequence
21 -> 331 RGRFCLTGGFRDMYIVKNNRMFYALLIAISVQSVGVFALIQAGLLTYEAGAFPWLGTVIGGYIFGLGIVLAGGCATGTWYRAGEGLIGSWIALFTYMVMSAVMRSPHASGLNQTLQHYSTEHNSIAETFNLSVWPLVAVLLVITLWVVMKELKKPKLKVATLPPRRTGIAHILFEKRWHPFVTAVLIGLIALLAWPLSEATGRMFGLGITSPTANILQFLVAGDMKYINWGVFLVLGIFVGSFIAAKASREFRVRAADAQTTLRSGLGGVLMGFGASIAGGCSIGNGLVMTAMMTWQGWIGLVFMILGVWT
71 -> 91 AFPWLGTVIGGYIFGLGIVLA
198 -> 218 WHPFVTAVLIGLIALLAWPLS
45 -> 65 LLIAISVQSVGVFALIQAGLL
103 -> 123 GEGLIGSWIALFTYMVMSAVM

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Fantino JR., et al., 2010
External database links:  
ECOCYC:
EG11895-MONOMER
ECOLIWIKI:
b2013
INTERPRO:
IPR007272
PFAM:
PF04143
PRIDE:
P33015
REFSEQ:
NP_416517
UNIPROT:
P33015


Operon      
Name: yeeED         
Operon arrangement:
Transcription unit        Promoter
yeeED


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2320 2084549 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2321 2085498 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Fantino JR., Py B., Fontecave M., Barras F., 2010, A genetic analysis of the response of Escherichia coli to cobalt stress., Environ Microbiol 12(10):2846-57

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB