RegulonDB RegulonDB 10.8: Gene Form
   

rpoE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nadB rseA rpoE rseD yfiC IHF GlrR NadR GlrR RcsB NtrC GlrR CRP CpxR DksA DksA DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp ppGpp ppGpp terminator rpoEp1b rpoEp1b TSS_2873 TSS_2873 nadBp nadBp rpoEp2b rpoEp2b rpoEp4 rpoEp4 rpoEp1a rpoEp1a rpoEp5 rpoEp5 rpoEp2a rpoEp2a TSS_2871 TSS_2871 TSS_2870 TSS_2870 rseAp3 rseAp3 TSS_2869 TSS_2869

Gene      
Name: rpoE    Texpresso search in the literature
Synonym(s): ECK2571, EG11897, b2573, sigE
Genome position(nucleotides): 2709437 <-- 2710012 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.78
External database links:  
ASAP:
ABE-0008467
CGSC:
36181
ECHOBASE:
EB1843
OU-MICROARRAY:
b2573
PortEco:
rpoE
STRING:
511145.b2573
COLOMBOS: rpoE


Product      
Name: RNA polymerase sigma E factor
Synonym(s): sigma;24, RNA polymerase, sigma 24 (sigma E) factor, RpoE, SigE, sigma 24 factor, sigma E factor
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.696
Isoelectric point: 5.13
Motif(s):
 
Type Positions Sequence
25 -> 25 L
178 -> 178 R
1 -> 153 MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRALDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAENFESGGALKEISNPENLMLSEELRQIVFRTIESLPEDLRMAITLRELDG
165 -> 165 C
156 -> 175 YEEIAAIMDCPVGTVRSRIF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.1 - sigma factors, anti-sigmafactors
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.3 - stimulon
  5 - cell processes --> 5.5 - adaptations --> 5.5.2 - temperature extremes
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0016987 - sigma factor activity
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006970 - response to osmotic stress
GO:0009266 - response to temperature stimulus
GO:0006352 - DNA-templated transcription, initiation
GO:2000142 - regulation of DNA-templated transcription, initiation
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Frohlich KS., et al., 2018
[2] Raina S., et al., 1995
External database links:  
DIP:
DIP-10774N
DISPROT:
DP01505
ECOCYC:
RPOE-MONOMER
ECOLIWIKI:
b2573
INTERPRO:
IPR013325
INTERPRO:
IPR039425
INTERPRO:
IPR036388
INTERPRO:
IPR014286
INTERPRO:
IPR014284
INTERPRO:
IPR013324
INTERPRO:
IPR013249
INTERPRO:
IPR007627
INTERPRO:
IPR000838
MODBASE:
P0AGB6
PANTHER:
PTHR43133
PDB:
1OR7
PDB:
5OR5
PDB:
6JBQ
PDB:
2H27
PFAM:
PF08281
PFAM:
PF04542
PRIDE:
P0AGB6
PRODB:
PRO_000023848
PROSITE:
PS01063
REFSEQ:
NP_417068
SMR:
P0AGB6
SWISSMODEL:
P0AGB6
UNIPROT:
P0AGB6


Operon      
Name: rseD-rpoE-rseABC         
Operon arrangement:
Transcription unit        Promoter
rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC
rpoE-rseABC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, NtrC, GlrR, RcsB
Repressed by: CpxR, IHF


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2869 2709043 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2870 2709761 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2871 2709854 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2873 2710392 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Frohlich KS., Gottesman S., 2018, Small Regulatory RNAs in the Enterobacterial Response to Envelope Damage and Oxidative Stress., Microbiol Spectr 6(4)

 [2] Raina S., Missiakas D., Georgopoulos C., 1995, The rpoE gene encoding the sigma E (sigma 24) heat shock sigma factor of Escherichia coli., EMBO J 14(5):1043-55

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB