RegulonDB RegulonDB 10.8: Gene Form
   

recT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recE recT racC ralR rcbA ralA

Gene      
Name: recT    Texpresso search in the literature
Synonym(s): ECK1346, EG11899, b1349
Genome position(nucleotides): 1413984 <-- 1414793 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.16
External database links:  
ASAP:
ABE-0004529
CGSC:
32070
ECHOBASE:
EB1844
OU-MICROARRAY:
b1349
PortEco:
recT
STRING:
511145.b1349
COLOMBOS: recT


Product      
Name: Rac prophage; recombinase RecT
Synonym(s): RecT, recombinase, DNA renaturation
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.721
Isoelectric point: 8.668
Motif(s):
 
Type Positions Sequence
54 -> 244 RMIRIATTEIRKVPALGNCDTMSFVSAIVQCSQLGLEPGSALGHAYLLPFGNKNEKSGKKNVQLIIGYRGMIDLARRSGQIASLSARVVREGDEFSFEFGLDEKLIHRPGENEDAPVTHVYAVARLKDGGTQFEVMTRKQIELVRSLSKAGNNGPWVTHWEEMAKKTAIRRLFKYLPVSIEIQRAVSMDEK

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0003697 - single-stranded DNA binding
GO:0005515 - protein binding
biological_process GO:0006259 - DNA metabolic process
GO:0006310 - DNA recombination
GO:0032508 - DNA duplex unwinding
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IGI] Inferred from genetic interaction
Reference(s): [1] Clark AJ., et al., 1993
[2] Hall SD., et al., 1993
[3] Hall SD., et al., 1994
[4] Handa N., et al., 2003
[5] Handa N., et al., 2005
[6] Kingston AW., et al., 2017
[7] Kusano K., et al., 1994
[8] Shiraishi K., et al., 2002
External database links:  
DIP:
DIP-10657N
ECOCYC:
EG11899-MONOMER
ECOLIWIKI:
b1349
INTERPRO:
IPR004590
INTERPRO:
IPR018330
PFAM:
PF03837
PRIDE:
P33228
PRODB:
PRO_000023708
REFSEQ:
NP_415865
UNIPROT:
P33228


Operon      
Name: recET-ralR-rcbA-xisR-intR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Clark AJ., Sharma V., Brenowitz S., Chu CC., Sandler S., Satin L., Templin A., Berger I., Cohen A., 1993, Genetic and molecular analyses of the C-terminal region of the recE gene from the Rac prophage of Escherichia coli K-12 reveal the recT gene., J Bacteriol 175(23):7673-82

 [2] Hall SD., Kane MF., Kolodner RD., 1993, Identification and characterization of the Escherichia coli RecT protein, a protein encoded by the recE region that promotes renaturation of homologous single-stranded DNA., J Bacteriol 175(1):277-87

 [3] Hall SD., Kolodner RD., 1994, Homologous pairing and strand exchange promoted by the Escherichia coli RecT protein., Proc Natl Acad Sci U S A 91(8):3205-9

 [4] Handa N., Kobayashi I., 2003, Accumulation of large non-circular forms of the chromosome in recombination-defective mutants of Escherichia coli., BMC Mol Biol 4:5

 [5] Handa N., Kobayashi I., 2005, Type III restriction is alleviated by bacteriophage (RecE) homologous recombination function but enhanced by bacterial (RecBCD) function., J Bacteriol 187(21):7362-73

 [6] Kingston AW., Ponkratz C., Raleigh EA., 2017, Rpn (YhgA-Like) Proteins of Escherichia coli K-12 and Their Contribution to RecA-Independent Horizontal Transfer., J Bacteriol 199(7)

 [7] Kusano K., Takahashi NK., Yoshikura H., Kobayashi I., 1994, Involvement of RecE exonuclease and RecT annealing protein in DNA double-strand break repair by homologous recombination., Gene 138(1-2):17-25

 [8] Shiraishi K., Hanada K., Iwakura Y., Ikeda H., 2002, Roles of RecJ, RecO, and RecR in RecET-mediated illegitimate recombination in Escherichia coli., J Bacteriol 184(17):4715-21


RegulonDB