RegulonDB RegulonDB 10.8: Gene Form
   

ralR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recT rcbA ralR ralA recE ralAp ralAp

Gene      
Name: ralR    Texpresso search in the literature
Synonym(s): ECK1345, EG11900, b1348, lar, ydaB
Genome position(nucleotides): 1413733 <-- 1413927 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.51
External database links:  
ASAP:
ABE-0004524
CGSC:
37053
ECHOBASE:
EB1845
OU-MICROARRAY:
b1348
PortEco:
lar
STRING:
511145.b1348
COLOMBOS: ralR


Product      
Name: Rac prophage; endodeoxyribonuclease toxin RalR
Synonym(s): Lar, Rac prophage, DNA endonuclease toxin of the RalRA toxin-antitoxin system, restriction alleviation and modification enhancement, RalR, YdaB
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.019
Isoelectric point: 9.033
Motif(s):
 
Type Positions Sequence
5 -> 54 NVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRT
52 -> 52 K
43 -> 46 EKEA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0016787 - hydrolase activity
GO:1990238 - double-stranded DNA endodeoxyribonuclease activity
biological_process GO:0009307 - DNA restriction-modification system
GO:0046677 - response to antibiotic
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
[IGI] Inferred from genetic interaction
Reference(s): [1] Blakely GW., et al., 2006
[2] Clark AJ., et al., 1993
[3] Guo Y., et al., 2014
[4] Handa N., et al., 2005
[5] King G., et al., 1995
[6] Simmon VF., et al., 1972
[7] Toothman P. 1981
External database links:  
ECOCYC:
EG11900-MONOMER
ECOLIWIKI:
b1348
INTERPRO:
IPR019908
PFAM:
PF14354
PRIDE:
P33229
PRODB:
PRO_000023073
REFSEQ:
NP_415864
UNIPROT:
P33229


Operon      
Name: recET-ralR-rcbA-xisR-intR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter intRp4 1413260 reverse Similarity to the consensus
Read more >
[ICWHO] [8]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Blakely GW., Murray NE., 2006, Control of the endonuclease activity of type I restriction-modification systems is required to maintain chromosome integrity following homologous recombination., Mol Microbiol 60(4):883-93

 [2] Clark AJ., Sharma V., Brenowitz S., Chu CC., Sandler S., Satin L., Templin A., Berger I., Cohen A., 1993, Genetic and molecular analyses of the C-terminal region of the recE gene from the Rac prophage of Escherichia coli K-12 reveal the recT gene., J Bacteriol 175(23):7673-82

 [3] Guo Y., Quiroga C., Chen Q., McAnulty MJ., Benedik MJ., Wood TK., Wang X., 2014, RalR (a DNase) and RalA (a small RNA) form a type I toxin-antitoxin system in Escherichia coli., Nucleic Acids Res 42(10):6448-62

 [4] Handa N., Kobayashi I., 2005, Type III restriction is alleviated by bacteriophage (RecE) homologous recombination function but enhanced by bacterial (RecBCD) function., J Bacteriol 187(21):7362-73

 [5] King G., Murray NE., 1995, Restriction alleviation and modification enhancement by the Rac prophage of Escherichia coli K-12., Mol Microbiol 16(4):769-77

 [6] Simmon VF., Lederberg S., 1972, Degradation of bacteriophage lambda deoxyribonucleic acid after restriction by Escherichia coli K-12., J Bacteriol 112(1):161-9

 [7] Toothman P., 1981, Restriction alleviation by bacteriophages lambda and lambda reverse., J Virol 38(2):621-31

 [8] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB