RegulonDB RegulonDB 10.8: Gene Form
   

yjbF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjbH yjbG yjbF yjbE

Gene      
Name: yjbF    Texpresso search in the literature
Synonym(s): ECK4019, EG11924, b4027
Genome position(nucleotides): 4236262 --> 4236900 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.77
External database links:  
ASAP:
ABE-0013172
ECHOBASE:
EB1868
OU-MICROARRAY:
b4027
PortEco:
yjbF
STRING:
511145.b4027
COLOMBOS: yjbF


Product      
Name: lipoprotein YjbF
Synonym(s): YjbF
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 23.755
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
16 -> 212 CSATTKELGNSLWDSLFGTPGVQLTDDDIQNMPYASQYMQLNGGPQLFVVLAFAEDGQQKWVTQDQATLVTQHGRLVKTLLGGDNLIEVNNLAADPLIKPAQIVDGASWTRTMGWTEYQQVRYATARSVFKWDGTDTVKVGSDETPVRVLDEEVSTDQARWHNRYWIDSEGQIRQSEQYLGADYFPVKTTLIKAAKQ
25 -> 206 NSLWDSLFGTPGVQLTDDDIQNMPYASQYMQLNGGPQLFVVLAFAEDGQQKWVTQDQATLVTQHGRLVKTLLGGDNLIEVNNLAADPLIKPAQIVDGASWTRTMGWTEYQQVRYATARSVFKWDGTDTVKVGSDETPVRVLDEEVSTDQARWHNRYWIDSEGQIRQSEQYLGADYFPVKTTL
1 -> 15 MKRPALILICLLLQA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
biological_process GO:0045226 - extracellular polysaccharide biosynthetic process
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Ferrieres L., et al., 2007
External database links:  
ECOCYC:
EG11924-MONOMER
ECOLIWIKI:
b4027
INTERPRO:
IPR023373
INTERPRO:
IPR021308
PFAM:
PF11102
PRIDE:
P32687
PROSITE:
PS51257
REFSEQ:
NP_418451
SMR:
P32687
UNIPROT:
P32687


Operon      
Name: yjbEFGH         
Operon arrangement:
Transcription unit        Promoter
yjbE
yjbEFGH
yjbEFGH
 


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, RcsAB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Ferrieres L., Aslam SN., Cooper RM., Clarke DJ., 2007, The yjbEFGH locus in Escherichia coli K-12 is an operon encoding proteins involved in exopolysaccharide production., Microbiology 153(Pt 4):1070-80


RegulonDB