RegulonDB RegulonDB 10.7: Gene Form
   

zur gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zur yjbL yjbJ yjbLp5 yjbLp5 zurp6 zurp6 zurp7 zurp7 TSS_4884 TSS_4884 TSS_4883 TSS_4883

Gene      
Name: zur    Texpresso search in the literature
Synonym(s): ECK4038, EG11929, b4046, yjbK, znuR
Genome position(nucleotides): 4259488 <-- 4260003 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.13
External database links:  
ASAP:
ABE-0013249
ECHOBASE:
EB1873
OU-MICROARRAY:
b4046
PORTECO:
zur
REGULONDB:
b4046
STRING:
511145.b4046
M3D: zur
COLOMBOS: zur
PortEco: b4046


Product      
Name: DNA-binding transcriptional repressor Zur
Synonym(s): YjbK, ZnuR, Zur
Sequence: Get amino acid sequence Fasta Format
Regulator Family: Fur
Cellular location: cytosol
Molecular weight: 19.254
Isoelectric point: 6.402
Motif(s):
 
Type Positions Sequence
20 -> 138 RNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREAEPQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMFICDRCGAVKEECAEGVEDIMHTLAAKMGFALRHNVIE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.1 - DNA structure level
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0008270 - zinc ion binding
GO:0042802 - identical protein binding
GO:0044212 - transcription regulatory region DNA binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
biological_process GO:1900376 - regulation of secondary metabolite biosynthetic process
GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Reference(s): [1] Hantke K. 2001
[2] Hantke K. 2002
[3] Outten CE., et al., 2001
[4] Panina EM., et al., 2003
External database links:  
DIP:
DIP-12953N
ECOCYC:
EG11929-MONOMER
ECOLIWIKI:
b4046
INTERPRO:
IPR036390
INTERPRO:
IPR002481
INTERPRO:
IPR036388
MODBASE:
P0AC51
PANTHER:
PTHR33202
PDB:
4MTE
PDB:
4MTD
PFAM:
PF01475
PRIDE:
P0AC51
PRODB:
PRO_000024259
PROTEINMODELPORTAL:
P0AC51
REFSEQ:
NP_418470
SMR:
P0AC51
UNIPROT:
P0AC51


Operon      
Name: zur         
Operon arrangement:
Transcription unit        Promoter
zur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4883 4259857 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_4884 4260031 reverse nd [RS-EPT-CBR] [5]
  promoter zurp7 4260114 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter zurp6 4260141 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter yjbLp5 4260159 forward Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Hantke K., 2001, Bacterial zinc transporters and regulators., Biometals 14(3-4):239-49

 [2] Hantke K., 2002, Members of the Fur protein family regulate iron and zinc transport in E. coli and characteristics of the Fur-regulated fhuF protein., J Mol Microbiol Biotechnol 4(3):217-22

 [3] Outten CE., Tobin DA., Penner-Hahn JE., O'Halloran TV., 2001, Characterization of the metal receptor sites in Escherichia coli Zur, an ultrasensitive zinc(II) metalloregulatory protein., Biochemistry 40(35):10417-23

 [4] Panina EM., Mironov AA., Gelfand MS., 2003, Comparative genomics of bacterial zinc regulons: enhanced ion transport, pathogenesis, and rearrangement of ribosomal proteins., Proc Natl Acad Sci U S A 100(17):9912-7

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB