RegulonDB RegulonDB 10.9: Gene Form
   

pspG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dusA pspG pspH qorA IHF PspF pspGp pspGp

Gene      
Name: pspG    Texpresso search in the literature
Synonym(s): ECK4042, EG11933, b4050, yjbO
Genome position(nucleotides): 4262840 --> 4263082 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.79
External database links:  
ASAP:
ABE-0013260
ECHOBASE:
EB1877
ECOLIHUB:
pspG
OU-MICROARRAY:
b4050
STRING:
511145.b4050
COLOMBOS: pspG


Product      
Name: phage shock protein G
Synonym(s): PspG, YjbO
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 9.023
Isoelectric point: 10.789
Motif(s):
 
Type Positions Sequence
1 -> 63 MLELLFVIGFFVMLMVTGVSLLGIIAALVVATAIMFLGGMLALMIKLLPWLLLAIAVVWVIKA
5 -> 25 LFVIGFFVMLMVTGVSLLGII
41 -> 61 LALMIKLLPWLLLAIAVVWVI

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0009271 - phage shock
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11933-MONOMER
ECOLIWIKI:
b4050
INTERPRO:
IPR014318
PFAM:
PF09583
PRIDE:
P32696
REFSEQ:
NP_418474
UNIPROT:
P32696


Operon      
Name: pspG         
Operon arrangement:
Transcription unit        Promoter
pspG


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, PspF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB