RegulonDB RegulonDB 10.9: Gene Form
   

yjcH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

acs actP yjcF yjcH actPp actPp yjcFp6 yjcFp6

Gene      
Name: yjcH    Texpresso search in the literature
Synonym(s): ECK4061, EG11943, b4068
Genome position(nucleotides): 4284899 <-- 4285213 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.21
External database links:  
ASAP:
ABE-0013330
ECHOBASE:
EB1887
ECOLIHUB:
yjcH
OU-MICROARRAY:
b4068
STRING:
511145.b4068
COLOMBOS: yjcH


Product      
Name: DUF485 domain-containing inner membrane protein YjcH
Synonym(s): YjcH
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 11.672
Isoelectric point: 7.688
Motif(s):
 
Type Positions Sequence
62 -> 84 TRGIPIGVGVIVISFVLTGIYIW
25 -> 47 FATILSIIMLAVYIGFILLIAFA
11 -> 98 DNAHFRELVEKRQRFATILSIIMLAVYIGFILLIAFAPGWLGTPLNPNTSVTRGIPIGVGVIVISFVLTGIYIWRANGEFDRLNNEVL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YJCH-MONOMER
ECOLIWIKI:
b4068
INTERPRO:
IPR007436
PFAM:
PF04341
PRIDE:
P0AF54
REFSEQ:
NP_418492
UNIPROT:
P0AF54


Operon      
Name: acs-yjcH-actP         
Operon arrangement:
Transcription unit        Promoter
actP
acs-yjcHG
acs-yjcHG
acs-yjcHG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: IHF, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjcFp6 4283106 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB