RegulonDB RegulonDB 10.8: Gene Form
   

nrfB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nrfA nrfD nrfC nrfB

Gene      
Name: nrfB    Texpresso search in the literature
Synonym(s): ECK4064, EG11945, b4071, yjcI
Genome position(nucleotides): 4289245 --> 4289811 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.97
External database links:  
ASAP:
ABE-0013344
CGSC:
34364
ECHOBASE:
EB1888
OU-MICROARRAY:
b4071
PortEco:
nrfB
STRING:
511145.b4071
COLOMBOS: nrfB


Product      
Name: periplasmic nitrite reductase penta-heme c-type cytochrome
Synonym(s): NrfB, YjcI
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 20.714
Isoelectric point: 7.263
Motif(s):
 
Type Positions Sequence
36 -> 83 RYEVTQQRNPDAACLDCHKPDTEGMHGKHASVINPNNKLPVTCTNCHG
1 -> 32 MSVLRSLLTAGVLASGLLWSLNGITATPAAQA
33 -> 188 SDDRYEVTQQRNPDAACLDCHKPDTEGMHGKHASVINPNNKLPVTCTNCHGQPSPQHREGVKDVMRFNEPMYKVGEQNSVCMSCHLPEQLQKAFWPHDVHVTKVACASCHSLHPQQDTMQTLSDKGRIKICVDCHSDQRTNPNFNPASVPLLKEQP
133 -> 171 VTKVACASCHSLHPQQDTMQTLSDKGRIKICVDCHSDQR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0042279 - nitrite reductase (cytochrome, ammonia-forming) activity
GO:0020037 - heme binding
biological_process GO:0006807 - nitrogen compound metabolic process
GO:0019645 - anaerobic electron transport chain
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
CYTOCHROMEC-MONOMER
ECOLIWIKI:
b4071
INTERPRO:
IPR011031
INTERPRO:
IPR036280
INTERPRO:
IPR023155
INTERPRO:
IPR017564
INTERPRO:
IPR010177
MODBASE:
P0ABL1
PDB:
2P0B
PDB:
2OZY
PFAM:
PF09699
PFAM:
PF13435
PRIDE:
P0ABL1
PRODB:
PRO_000023412
PROSITE:
PS51008
REFSEQ:
NP_418495
SMR:
P0ABL1
UNIPROT:
P0ABL1


Operon      
Name: nrfABCDEFG         
Operon arrangement:
Transcription unit        Promoter
nrfABCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, NarL, FlhDC, NarP
Repressed by: NsrR, IHF, NarL, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB