RegulonDB RegulonDB 10.8: Gene Form
   

nrfD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nrfE nrfD nrfC nrfB nrfF

Gene      
Name: nrfD    Texpresso search in the literature
Synonym(s): ECK4066, EG11947, b4073, yjcK
Genome position(nucleotides): 4290476 --> 4291432 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.58
External database links:  
ASAP:
ABE-0013348
CGSC:
34355
ECHOBASE:
EB1890
OU-MICROARRAY:
b4073
PortEco:
nrfD
STRING:
511145.b4073
COLOMBOS: nrfD


Product      
Name: putative menaquinol-cytochrome c reductase subunit NrfD
Synonym(s): NrfD, YjcK
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 35.042
Isoelectric point: 10.292
Motif(s):
 
Type Positions Sequence
288 -> 310 IPAVLAACGASLVGVLMLRFFIL
5 -> 318 SAFHFESLVWDWPIAIYLFLIGISAGLVTLAVLLRRFYPQAGGADSTLLRTTLIVGPGAVILGLLILVFHLTRPWTFWKLMFHYSFTSVMSMGVMLFQLYMVVLVLWLAKIFEHDLLALQQRWLPKLGIVQKVLSLLTPVHRGLETLMLVLAVLLGAYTGFLLSALKSYPFLNNPILPVLFLFSGISSGAAVALIAMAIRQRSNPHSTEAQFVHRMEIPVVWGEIFLLVAFFVGLALGDDGKVRALVAALGGGFWTWWFWLGVAGLGLIVPMLLKPWVNRSSGIPAVLAACGASLVGVLMLRFFILYAGQLTVA
18 -> 38 IAIYLFLIGISAGLVTLAVLL
150 -> 170 TLMLVLAVLLGAYTGFLLSAL
258 -> 278 FWTWWFWLGVAGLGLIVPMLL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0019645 - anaerobic electron transport chain
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
NRFD-MONOMER
ECOLIWIKI:
b4073
INTERPRO:
IPR005614
INTERPRO:
IPR017566
PFAM:
PF03916
PRIDE:
P32709
PRODB:
PRO_000023414
REFSEQ:
NP_418497
UNIPROT:
P32709


Operon      
Name: nrfABCDEFG         
Operon arrangement:
Transcription unit        Promoter
nrfABCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, NarL, NarP, FlhDC
Repressed by: NsrR, IHF, NarL, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB