RegulonDB RegulonDB 10.8: Gene Form
   

nrfG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nrfE gltP nrfG nrfF gltPp1 gltPp1 gltPp6 gltPp6 gltPp8 gltPp8

Gene      
Name: nrfG    Texpresso search in the literature
Synonym(s): ECK4069, EG11950, aidC, b4076, yjcN
Genome position(nucleotides): 4293543 --> 4294139 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.76
External database links:  
ASAP:
ABE-0013354
CGSC:
34345
ECHOBASE:
EB1893
OU-MICROARRAY:
b4076
PortEco:
nrfG
STRING:
511145.b4076
COLOMBOS: nrfG


Product      
Name: putative formate-dependent nitrite reductase complex subunit NrfG
Synonym(s): AidC, NrfG, YjcN
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 22.784
Isoelectric point: 8.873
Motif(s):
 
Type Positions Sequence
73 -> 106 SEQWALLGEYYLWQNDYSNSLLAYRQALQLRGEN
7 -> 28 PVKMLTTLTILMVFLCVGSYLL
144 -> 177 ITALMLLASDAFMQANYAQAIELWQKVMDLNSPR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0005887 - integral component of plasma membrane
biological_process GO:0018378 - cytochrome c-heme linkage via heme-L-cysteine
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Eaves DJ., et al., 1998
External database links:  
ECOCYC:
EG11950-MONOMER
ECOLIWIKI:
b4076
INTERPRO:
IPR011990
INTERPRO:
IPR019734
INTERPRO:
IPR013026
MODBASE:
P32712
PANTHER:
PTHR26312:SF27
PRIDE:
P32712
PRODB:
PRO_000023416
PROSITE:
PS50293
PROSITE:
PS50005
REFSEQ:
NP_418500
SMART:
SM00028
SMR:
P32712
UNIPROT:
P32712


Operon      
Name: nrfABCDEFG         
Operon arrangement:
Transcription unit        Promoter
nrfABCDEFG


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, NarL, NarP, FlhDC
Repressed by: NsrR, IHF, NarL, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter gltPp8 4294268 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter gltPp6 4294307 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter gltPp1 4294378 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Eaves DJ., Grove J., Staudenmann W., James P., Poole RK., White SA., Griffiths I., Cole JA., 1998, Involvement of products of the nrfEFG genes in the covalent attachment of haem c to a novel cysteine-lysine motif in the cytochrome c552 nitrite reductase from Escherichia coli., Mol Microbiol 28(1):205-16

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB