RegulonDB RegulonDB 10.9: Gene Form
   

alsE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjcS alsC alsK alsE alsA alsEp3 alsEp3 alsEp2 alsEp2 alsKp1 alsKp1

Gene      
Name: alsE    Texpresso search in the literature
Synonym(s): ECK4078, EG11957, b4085, yjcU
Genome position(nucleotides): 4307783 <-- 4308478 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.14
External database links:  
ASAP:
ABE-0013382
ECHOBASE:
EB1900
ECOLIHUB:
alsE
OU-MICROARRAY:
b4085
STRING:
511145.b4085
COLOMBOS: alsE


Product      
Name: D-allulose-6-phosphate 3-epimerase
Synonym(s): AlsE, YjcU
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.109
Isoelectric point: 5.321
Motif(s):
 
Type Positions Sequence
140 -> 143 GFAG
173 -> 175 DGS
195 -> 197 GTS
196 -> 196 T
2 -> 196 KISPSLMCMDLLKFKEQIEFIDSHADYFHIDIMDGHFVPNLTLSPFFVSQVKKLATKPLDCHLMVTRPQDYIAQLARAGADFITLHPETINGQAFRLIDEIRRHDMKVGLILNPETPVEAMKYYIHKADKITVMTVDPGFAGQPFIPEMLDKLAELKAWREREGLEYEIEVDGSCNQATYEKLMAAGADVFIVGT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0016857 - racemase and epimerase activity, acting on carbohydrates and derivatives
GO:0004750 - ribulose-phosphate 3-epimerase activity
GO:0034700 - allulose 6-phosphate 3-epimerase activity
biological_process GO:0044262 - cellular carbohydrate metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0009052 - pentose-phosphate shunt, non-oxidative branch
GO:0019323 - pentose catabolic process
GO:0019316 - D-allose catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11957-MONOMER
ECOLIWIKI:
b4085
INTERPRO:
IPR011060
INTERPRO:
IPR013785
INTERPRO:
IPR000056
MODBASE:
P32719
PANTHER:
PTHR11749
PDB:
3CTL
PDB:
3CT7
PFAM:
PF00834
PRIDE:
P32719
PRODB:
PRO_000022090
PROSITE:
PS01085
PROSITE:
PS01086
REFSEQ:
NP_418509
SMR:
P32719
UNIPROT:
P32719


Operon      
Name: alsRBACE         
Operon arrangement:
Transcription unit        Promoter
alsRBACE
alsRBACE
alsBACE


Transcriptional Regulation      
Display Regulation             
Repressed by: AlsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter alsKp1 4307995 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter alsEp2 4308664 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter alsEp3 4308667 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB