RegulonDB RegulonDB 10.9: Gene Form
   

alsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

alsA alsC alsB alsE alsK alsEp3 alsEp3 alsEp2 alsEp2 alsKp1 alsKp1

Gene      
Name: alsA    Texpresso search in the literature
Synonym(s): ECK4080, EG11959, b4087, yjcW
Genome position(nucleotides): 4309448 <-- 4310980 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.95
External database links:  
ASAP:
ABE-0013394
ECHOBASE:
EB1902
ECOLIHUB:
alsA
ECOO157CYC:
Z5691
OU-MICROARRAY:
b4087
STRING:
511145.b4087
COLOMBOS: alsA


Product      
Name: D-allose ABC transporter ATP binding subunit
Synonym(s): AlsA, YjcW
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 56.745
Isoelectric point: 7.454
Motif(s):
 
Type Positions Sequence
21 -> 174 LKSVNLTVYPGEIHALLGENGAGKSTLMKVLSGIHEPTKGTITINNISYNKLDHKLAAQLGIGIIYQELSVIDELTVLENLYIGRHLTKKICGVNIIDWREMRVRAAMMLLRVGLKVDLDEKVANLSISHKQMLEIAKTLMLDAKVIIMDEPTS
166 -> 173 VIIMDEPT
280 -> 437 RDISFSVCRGEILGFAGLVGSGRTELMNCLFGVDKRAGGEIRLNGKDISPRSPLDAVKKGMAYITESRRDNGFFPNFSIAQNMAISRSLKDGGYKGAMGLFHEVDEQRTAENQRELLALKCHSVNQNITELSGGNQQKVLISKWLCCCPEVIIFDEPT
430 -> 437 VIIFDEPT
38 -> 45 GENGAGKS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015593 - allose transmembrane transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0015754 - allose transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9093N
ECOCYC:
YJCW-MONOMER
ECOLIWIKI:
b4087
ECOO157CYC:
Z5691-MONOMER
INTERPRO:
IPR003593
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003439
MODBASE:
P32721
PFAM:
PF00005
PRIDE:
P32721
PRODB:
PRO_000022087
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_418511
SMART:
SM00382
SMR:
P32721
UNIPROT:
P32721


Operon      
Name: alsRBACE         
Operon arrangement:
Transcription unit        Promoter
alsRBACE
alsRBACE
alsBACE


Transcriptional Regulation      
Display Regulation             
Repressed by: AlsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter alsKp1 4307995 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter alsEp2 4308664 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter alsEp3 4308667 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB