RegulonDB RegulonDB 10.6.3: Gene Form
   

lldR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lldP lldD lldR trmL yibL LldR ArcA ArcA LldR terminator anti-terminator lldPp lldPp

Gene      
Name: lldR    Texpresso search in the literature
Synonym(s): ECK3594, EG11962, b3604, lct, lctR
Genome position(nucleotides): 3779054 --> 3779830 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.05
Reference(s): [1] Erwin AL., et al., 1996
External database links:  
ASAP:
ABE-0011782
CGSC:
35164
ECHOBASE:
EB1905
ECOCYC:
EG11962
ECOLIHUB:
lldR
ECOO157CYC:
LLDR
OU-MICROARRAY:
b3604
REGULONDB:
b3604
STRING:
511145.b3604
M3D: lldR
COLOMBOS: lldR
PortEco: b3604


Shine dalgarno      
Sequence: tgtcttaacgTGGATGattccttaATG


Product      
Name: DNA-binding transcriptional dual regulator LldR
Synonym(s): Lct, LctR, LldR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GntR
Cellular location: cytosol
Molecular weight: 29.166
Isoelectric point: 6.927
Motif(s):
 
Type Positions Sequence
8 -> 71 LSDEVADRVRALIDEKNLEAGMKLPAERQLAMQLGVSRNSLREALAKLVSEGVLLSRRGGGTFI
34 -> 53 ERQLAMQLGVSRNSLREALA
6 -> 74 RRLSDEVADRVRALIDEKNLEAGMKLPAERQLAMQLGVSRNSLREALAKLVSEGVLLSRRGGGTFIRWR
100 -> 222 DILEARYAIEASTAWHAAMRATPGDKEKIQLCFEATLSEDPDIASQADVRFHLAIAEASHNIVLLQTMRGFFDVLQSSVKHSRQRMYLVPPVFSQLTEQHQAVIDAIFAGDADGARKAMMAHL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0006974 - cellular response to DNA damage stimulus
GO:0042710 - biofilm formation
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
DIP:
DIP-10110N
ECOCYC:
EG11962-MONOMER
ECOLIWIKI:
b3604
ECOO157CYC:
LLDR-MONOMER
INTERPRO:
IPR011711
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR000524
INTERPRO:
IPR008920
MODBASE:
P0ACL7
PFAM:
PF07729
PFAM:
PF00392
PRIDE:
P0ACL7
PRINTS:
PR00035
PROSITE:
PS50949
PROTEINMODELPORTAL:
P0ACL7
REFSEQ:
NP_418061
SMART:
SM00895
SMART:
SM00345
SMR:
P0ACL7
UNIPROT:
P0ACL7


Operon      
Name: lldPRD         
Operon arrangement:
Transcription unit        Promoter
lldPRD


Transcriptional Regulation      
Display Regulation             
Activated by: LldR
Repressed by: LldR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Erwin AL., Gotschlich EC., 1996, Cloning of a Neisseria meningitidis gene for L-lactate dehydrogenase (L-LDH): evidence for a second meningococcal L-LDH with different regulation., J Bacteriol 178(16):4807-13


RegulonDB