RegulonDB RegulonDB 10.6.3: Gene Form
   

lldD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lldP lldD lldR trmL terminator anti-terminator

Gene      
Name: lldD    Texpresso search in the literature
Synonym(s): ECK3595, EG11963, b3605, lct, lctD
Genome position(nucleotides): 3779827 --> 3781017 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.67
External database links:  
ASAP:
ABE-0011784
ECHOBASE:
EB1906
ECOCYC:
EG11963
ECOLIHUB:
lldD
ECOO157CYC:
LLDD
OU-MICROARRAY:
b3605
REGULONDB:
b3605
STRING:
511145.b3605
M3D: lldD
COLOMBOS: lldD
PortEco: b3605


Shine dalgarno      
Sequence: agcattcgagGGAGAAaaacgcATG


Product      
Name: L-lactate dehydrogenase
Synonym(s): Lct, LctD, LldD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 42.728
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
306 -> 330 DSGIRNGLDVVRMIALGADTVLLGR
1 -> 380 MIISAASDYRAAAQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSLETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMRRYLQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWIRDFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALATAGQAGVANLLNLIEKEMKVAMTLTGAKSISEITQDSLVQGLG
13 -> 375 AQRILPPFLFHYMDGGAYSEYTLRRNVEDLSEVALRQRILKNMSDLSLETTLFNEKLSMPVALAPVGLCGMYARRGEVQAAKAADAHGIPFTLSTVSVCPIEEVAPAIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGARYRDAHSGMSGPNAAMRRYLQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIGWLGNNFDPSISWKDLEWIRDFWDGPMVIKGILDPEDARDAVRFGADGIVVSNHGGRQLDGVLSSARALPAIADAVKGDIAILADSGIRNGLDVVRMIALGADTVLLGRAFLYALATAGQAGVANLLNLIEKEMKVAMTLTGAKSISEITQDSL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0003824 - catalytic activity
GO:0016491 - oxidoreductase activity
GO:0016614 - oxidoreductase activity, acting on CH-OH group of donors
GO:0004457 - lactate dehydrogenase activity
GO:0010181 - FMN binding
GO:0004459 - L-lactate dehydrogenase activity
biological_process GO:0009060 - aerobic respiration
GO:0009061 - anaerobic respiration
GO:0006089 - lactate metabolic process
GO:0042355 - L-fucose catabolic process
GO:0055114 - oxidation-reduction process
GO:0019516 - lactate oxidation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10108N
ECOCYC:
L-LACTDEHYDROGFMN-MONOMER
ECOLIWIKI:
b3605
INTERPRO:
IPR012133
INTERPRO:
IPR037396
INTERPRO:
IPR020920
INTERPRO:
IPR013785
INTERPRO:
IPR008259
INTERPRO:
IPR000262
MINT:
P33232
MODBASE:
P33232
PFAM:
PF01070
PRIDE:
P33232
PRODB:
PRO_000023100
PROSITE:
PS00557
PROSITE:
PS51349
PROTEINMODELPORTAL:
P33232
REFSEQ:
NP_418062
SMR:
P33232
UNIPROT:
P33232


Operon      
Name: lldPRD         
Operon arrangement:
Transcription unit        Promoter
lldPRD


Transcriptional Regulation      
Display Regulation             
Activated by: LldR
Repressed by: LldR, ArcA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB