RegulonDB RegulonDB 10.7: Gene Form
   

adiY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

adiA adiC adiY anti-anti-terminator anti-terminator terminator adiYp adiYp adiCp7 adiCp7

Gene      
Name: adiY    Texpresso search in the literature
Synonym(s): ECK4109, EG11966, b4116
Genome position(nucleotides): 4337168 <-- 4337929 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.34
External database links:  
ASAP:
ABE-0013479
CGSC:
35597
ECHOBASE:
EB1909
OU-MICROARRAY:
b4116
PORTECO:
adiY
REGULONDB:
b4116
STRING:
511145.b4116
M3D: adiY
COLOMBOS: adiY
PortEco: b4116


Product      
Name: DNA-binding transcriptional activator AdiY
Synonym(s): AdiY
Sequence: Get amino acid sequence Fasta Format
Regulator Family: AraC/XylS
Cellular location: cytosol
Molecular weight: 29.007
Isoelectric point: 8.317
Motif(s):
 
Type Positions Sequence
166 -> 187 SMVASCLCLSPSLLKKKLKSEN
149 -> 246 DSVYQIIESDIHKDWNLSMVASCLCLSPSLLKKKLKSENTSYSQIITTCRMRYAVNELMMDGKNISQVSQSCGYNSTSYFISVFKDFYGMTPLHYVSQ
213 -> 236 ISQVSQSCGYNSTSYFISVFKDFY
169 -> 244 ASCLCLSPSLLKKKLKSENTSYSQIITTCRMRYAVNELMMDGKNISQVSQSCGYNSTSYFISVFKDFYGMTPLHYV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0043565 - sequence-specific DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [GEA] Gene expression analysis
[HIFS] Human inference of function from sequence
Reference(s): [1] Stim-Herndon KP., et al., 1996
External database links:  
ECOCYC:
EG11966-MONOMER
ECOLIWIKI:
b4116
INTERPRO:
IPR009057
INTERPRO:
IPR018060
INTERPRO:
IPR018062
INTERPRO:
IPR020449
MODBASE:
P33234
PFAM:
PF12833
PRIDE:
P33234
PRINTS:
PR00032
PRODB:
PRO_000022060
PROSITE:
PS00041
PROSITE:
PS01124
PROTEINMODELPORTAL:
P33234
REFSEQ:
NP_418540
SMART:
SM00342
SMR:
P33234
UNIPROT:
P33234


Operon      
Name: adiY         
Operon arrangement:
Transcription unit        Promoter
adiY


Transcriptional Regulation      
Display Regulation             
Repressed by: H-NS


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Stim-Herndon KP., Flores TM., Bennett GN., 1996, Molecular characterization of adiY, a regulatory gene which affects expression of the biodegradative acid-induced arginine decarboxylase gene (adiA) of Escherichia coli., Microbiology 142 ( Pt 5):1311-20


RegulonDB