RegulonDB RegulonDB 10.6.3: Gene Form
   

zntR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zntR yhdN arfA mscL anti-terminator terminator zntRp2 zntRp2 arfAp3 arfAp3

Gene      
Name: zntR    Texpresso search in the literature
Synonym(s): ECK3279, EG11969, b3292, yhdM
Genome position(nucleotides): 3438705 <-- 3439130 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.83
External database links:  
ASAP:
ABE-0010793
ECHOBASE:
EB1912
ECOCYC:
EG11969
ECOLIHUB:
zntR
OU-MICROARRAY:
b3292
REGULONDB:
b3292
STRING:
511145.b3292
M3D: zntR
COLOMBOS: zntR
PortEco: b3292


Product      
Name: DNA-binding transcriptional activator ZntR
Synonym(s): YhdM, ZntR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 16.179
Isoelectric point: 6.351
Motif(s):
 
Type Positions Sequence
4 -> 23 IGELAKMAEVTPDTIRYYEK
1 -> 70 MYRIGELAKMAEVTPDTIRYYEKQQMMEHEVRTEGGFRLYTESDLQRLKFIRHARQLGFSLESIRELLSI
2 -> 69 YRIGELAKMAEVTPDTIRYYEKQQMMEHEVRTEGGFRLYTESDLQRLKFIRHARQLGFSLESIRELLS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0003700 - DNA-binding transcription factor activity
GO:0008270 - zinc ion binding
GO:0000986 - bacterial-type proximal promoter sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
Evidence: [AIFS] Automated inference of function from sequence
[BPP] Binding of purified proteins
[GEA] Gene expression analysis
Reference(s): [1] Binet MR., et al., 2000
[2] Brocklehurst KR., et al., 1999
[3] Khan S., et al., 2002
[4] Outten CE., et al., 1999
External database links:  
DIP:
DIP-48253N
ECOCYC:
EG11969-MONOMER
ECOLIWIKI:
b3292
INTERPRO:
IPR000551
INTERPRO:
IPR009061
INTERPRO:
IPR011788
MODBASE:
P0ACS5
PDB:
1Q0A
PDB:
1Q09
PDB:
1Q08
PFAM:
PF13411
PRIDE:
P0ACS5
PRINTS:
PR00040
PRODB:
PRO_000024251
PROSITE:
PS50937
PROSITE:
PS00552
PROTEINMODELPORTAL:
P0ACS5
REFSEQ:
NP_417751
SMART:
SM00422
SMR:
P0ACS5
UNIPROT:
P0ACS5


Operon      
Name: yhdN-zntR         
Operon arrangement:
Transcription unit        Promoter
yhdN-zntR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter zntRp2 3439168 reverse Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Binet MR., Poole RK., 2000, Cd(II), Pb(II) and Zn(II) ions regulate expression of the metal-transporting P-type ATPase ZntA in Escherichia coli., FEBS Lett 473(1):67-70

 [2] Brocklehurst KR., Hobman JL., Lawley B., Blank L., Marshall SJ., Brown NL., Morby AP., 1999, ZntR is a Zn(II)-responsive MerR-like transcriptional regulator of zntA in Escherichia coli., Mol Microbiol 31(3):893-902

 [3] Khan S., Brocklehurst KR., Jones GW., Morby AP., 2002, The functional analysis of directed amino-acid alterations in ZntR from Escherichia coli., Biochem Biophys Res Commun 299(3):438-45

 [4] Outten CE., Outten FW., O'Halloran TV., 1999, DNA distortion mechanism for transcriptional activation by ZntR, a Zn(II)-responsive MerR homologue in Escherichia coli., J Biol Chem 274(53):37517-24

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB