RegulonDB RegulonDB 10.8: Gene Form
   

fimI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fimC fimA fimI terminator anti-terminator TSS_5138 TSS_5138 TSS_5137 TSS_5137 TSS_5136 TSS_5136 TSS_5135 TSS_5135

Gene      
Name: fimI    Texpresso search in the literature
Synonym(s): ECK4306, EG11974, b4315
Genome position(nucleotides): 4543728 --> 4544267 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.26
External database links:  
ASAP:
ABE-0014147
ECHOBASE:
EB1917
OU-MICROARRAY:
b4315
PortEco:
fimI
STRING:
511145.b4315
COLOMBOS: fimI


Product      
Name: putative fimbrial protein FimI
Synonym(s): FimI
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 19.373
Isoelectric point: 9.94
Motif(s):
 
Type Positions Sequence
20 -> 179 GNKWNTTLPGGNMQFQGVIIAETCRIEAGDKQMTVNMGQISSNRFHAVGEDSAPVPFVIHLRECSTVVSERVGVAFHGVADGKNPDVLSVGEGPGIATNIGVALFDDEGNLVPINRPPANWKRLYSGSTSLHFIAKYRATGRRVTGGIANAQAWFSLTYQ
33 -> 179 QFQGVIIAETCRIEAGDKQMTVNMGQISSNRFHAVGEDSAPVPFVIHLRECSTVVSERVGVAFHGVADGKNPDVLSVGEGPGIATNIGVALFDDEGNLVPINRPPANWKRLYSGSTSLHFIAKYRATGRRVTGGIANAQAWFSLTYQ
1 -> 19 MKRKRLFLLASLLPMFALA
13 -> 13 L

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0009297 - pilus assembly
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9617N
ECOCYC:
EG11974-MONOMER
ECOLIWIKI:
b4315
INTERPRO:
IPR008966
INTERPRO:
IPR036937
INTERPRO:
IPR000259
MINT:
MINT-1256126
MODBASE:
P39264
PFAM:
PF00419
PRIDE:
P39264
PRODB:
PRO_000022624
REFSEQ:
NP_418735
SMR:
P39264
UNIPROT:
P39264


Operon      
Name: fimAICDFGH         
Operon arrangement:
Transcription unit        Promoter
fimAICDFGH


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS, IHF, Lrp, QseB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5135 4543121 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5136 4543128 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5137 4544668 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5138 4544808 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB