RegulonDB RegulonDB 10.8: Gene Form
   

rfbA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rfbX rfbD rfbA rfbC terminator TSS_2389 (cluster) TSS_2389 (cluster) rfbXp7 rfbXp7 rfbXp8 rfbXp8 rfbXp5 rfbXp5 rfbXp6 rfbXp6 TSS_2388 TSS_2388

Gene      
Name: rfbA    Texpresso search in the literature
Synonym(s): ECK2033, EG11978, b2039, rmlA, som
Genome position(nucleotides): 2110138 <-- 2111019 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.74
External database links:  
ASAP:
ABE-0006762
CGSC:
297
ECHOBASE:
EB1921
OU-MICROARRAY:
b2039
PortEco:
rfbA
STRING:
511145.b2039
COLOMBOS: rfbA


Product      
Name: dTDP-glucose pyrophosphorylase
Synonym(s): RfbA, RmlA, Som
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.694
Isoelectric point: 5.207
Motif(s):
 
Type Positions Sequence
247 -> 247 Q
5 -> 241 KGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRFQQLLGDGSQWGLNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYGVVEFDKNGTAISLEEKPLEPKSNYAVTGLYFYDNDVVQMAKNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.1 - O antigen
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.10 - sugar nucleotide biosynthesis, conversions
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016779 - nucleotidyltransferase activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008879 - glucose-1-phosphate thymidylyltransferase activity
GO:0042802 - identical protein binding
biological_process GO:0009058 - biosynthetic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009243 - O antigen biosynthetic process
GO:0045226 - extracellular polysaccharide biosynthetic process
GO:0019305 - dTDP-rhamnose biosynthetic process
External database links:  
ECOCYC:
DTDPGLUCOSEPP-MONOMER
ECOLIWIKI:
b2039
INTERPRO:
IPR029044
INTERPRO:
IPR005907
INTERPRO:
IPR005835
MODBASE:
P37744
PANTHER:
PTHR43532
PDB:
1H5S
PDB:
1H5R
PDB:
1H5T
PFAM:
PF00483
PRIDE:
P37744
PRODB:
PRO_000023783
REFSEQ:
NP_416543
SMR:
P37744
UNIPROT:
P37744


Operon      
Name: rfbBDACX         
Operon arrangement:
Transcription unit        Promoter
rfbACX
rfbBDACX


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2388 2108494 reverse nd [RS-EPT-CBR] [1]
  promoter rfbXp6 2109586 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rfbXp5 2109676 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rfbXp8 2109716 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter rfbXp7 2109718 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2389 (cluster) 2111073 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB