RegulonDB RegulonDB 10.8: Gene Form
   

glf gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rfbX wbbH glf wbbI wbbJ rfbC TSS_2388 TSS_2388 rfcp11 rfcp11 rfcp7 rfcp7 rfcp10 rfcp10 rfcp8 rfcp8 TSS_2387 TSS_2387 TSS_2386 TSS_2386 TSS_2385 TSS_2385

Gene      
Name: glf    Texpresso search in the literature
Synonym(s): ECK2030, EG11981, b2036, yefE
Genome position(nucleotides): 2107226 <-- 2108329 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
35.6
External database links:  
ASAP:
ABE-0006755
ECHOBASE:
EB1924
OU-MICROARRAY:
b2036
PortEco:
glf
STRING:
511145.b2036
COLOMBOS: glf


Product      
Name: UDP-galactopyranose mutase
Synonym(s): Glf, YefE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.966
Isoelectric point: 7.132
Motif(s):
 
Type Positions Sequence
311 -> 311 Y
31 -> 32 EK
151 -> 151 Y
6 -> 72 IVGSGLFGAVCANELKKLNKKVLVIEKRNHIGGNAYTEDCEGIQIHKYGAHIFHTNDKYIWDYVNDL
181 -> 181 Y

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide --> 1.6.3.1 - O antigen
  6 - cell structure --> 6.2 - murein
  6 - cell structure --> 6.3 - surface antigens (ECA, O antigen of LPS)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0008767 - UDP-galactopyranose mutase activity
GO:0050660 - flavin adenine dinucleotide binding
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Lee R., et al., 1996
External database links:  
DIP:
DIP-6863N
ECOCYC:
GALPMUT-MONOMER
ECOLIWIKI:
b2036
INTERPRO:
IPR015899
INTERPRO:
IPR004379
MINT:
MINT-1308638
MODBASE:
P37747
PANTHER:
PTHR21197
PDB:
1I8T
PFAM:
PF03275
PRIDE:
P37747
PRODB:
PRO_000022775
REFSEQ:
NP_416540
SMR:
P37747
UNIPROT:
P37747


Operon      
Name: glf-wbbH         
Operon arrangement:
Transcription unit        Promoter
glf-rfc


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2385 2105457 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2386 2106618 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2387 2106661 reverse nd [RS-EPT-CBR] [2]
  promoter rfcp8 2107234 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter rfcp10 2107283 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter rfcp7 2107394 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter rfcp11 2107444 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2388 2108494 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lee R., Monsey D., Weston A., Duncan K., Rithner C., McNeil M., 1996, Enzymatic synthesis of UDP-galactofuranose and an assay for UDP-galactopyranose mutase based on high-performance liquid chromatography., Anal Biochem 242(1):1-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB