RegulonDB RegulonDB 10.8: Gene Form
   

wbbK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wbbK wbbI insH7 wbbJ terminator TSS_2385 TSS_2385 TSS_2384 TSS_2384 TSS_2383 TSS_2383 wbbKp4 wbbKp4 TSS_2382 TSS_2382 TSS_2381 TSS_2381 insHp4 insHp4 insHp5 insHp5 insHp6 insHp6 TSS_2380 (cluster) TSS_2380 (cluster) TSS_2379 TSS_2379

Gene      
Name: wbbK    Texpresso search in the literature
Synonym(s): ECK2026, EG11985, b2032, yefI
Genome position(nucleotides): 2103391 <-- 2104509 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
31.9
External database links:  
ASAP:
ABE-0006747
ECHOBASE:
EB1928
OU-MICROARRAY:
b2032
PortEco:
wbbK
STRING:
511145.b2032
COLOMBOS: wbbK


Product      
Name: putative glycosyltransferase WbbK
Synonym(s): WbbK, YefI
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 43.188
Isoelectric point: 9.341
Motif(s):
 
Type Positions Sequence
189 -> 345 DSQFKNNPSELTIFYPAVPRVFKNYELIISAARKLKEQSNIKFLLTISGTENAYAKYIISLAEGLDNVHFLGYLDKEKIDHCYNISDIVCFPSRLETWGLPLSEAKERGKWVLASDFPFTRETLGSYEKKAFFDSNNDDMLVKLIIDFKKGNLKKDI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
biological_process GO:0009103 - lipopolysaccharide biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GT4
DIP:
DIP-11874N
ECOCYC:
EG11985-MONOMER
ECOLIWIKI:
b2032
INTERPRO:
IPR001296
MODBASE:
P37751
PFAM:
PF00534
PRIDE:
P37751
REFSEQ:
NP_416536
UNIPROT:
P37751


Operon      
Name: wbbIJK         
Operon arrangement:
Transcription unit        Promoter
wbbIJK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2379 2102902 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2380 (cluster) 2102949 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter insHp6 2103049 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp5 2103090 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter insHp4 2103093 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2381 2103462 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2382 2103479 reverse nd [RS-EPT-CBR] [1]
  promoter wbbKp4 2104606 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2383 2105007 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2384 2105046 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2385 2105457 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB