RegulonDB RegulonDB 10.8: Gene Form
   

yehA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehB yehA rcnB yehAp6 yehAp6

Gene      
Name: yehA    Texpresso search in the literature
Synonym(s): ECK2101, EG11987, b2108
Genome position(nucleotides): 2187380 <-- 2188414 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
38.74
External database links:  
ASAP:
ABE-0006972
ECHOBASE:
EB1930
OU-MICROARRAY:
b2108
PortEco:
yehA
STRING:
511145.b2108
COLOMBOS: yehA


Product      
Name: putative fimbrial adhesin YehA
Synonym(s): YehA
Sequence: Get amino acid sequence Fasta Format
Cellular location: pilus
Molecular weight: 36.885
Isoelectric point: 7.293
Motif(s):
 
Type Positions Sequence
184 -> 343 NLTLSYNPITTTCKPDDLLITLDSIPVSQLPATGNKATINSKQGDIILRCKNLLGQQNQTSRKMQVYLSSSDLLTNSNTILKGAEDNGVGFILESNGSPVTLLNITNSSKGYTNLKEVAAKSKLTDTTVSIPITASYYVYDTNKVKSGALEATALINVKY
1 -> 20 MEIRIMLFILMMMVMPVSYA
21 -> 344 ACYSELSVQHNLVVQGDFALTQTQMATYEHNFNDSSCVSTNTITPMSPSDIIVGLYNDTIKLNLHFEWTNKNNITLSNNQTSFTSGYSVTVTPAASNAKVNVSAGGGGSVMINGVATLSSASSSTRGSAAVQFLLCLLGGKSWDACVNSYRNALAQNAGVYSFNLTLSYNPITTTCKPDDLLITLDSIPVSQLPATGNKATINSKQGDIILRCKNLLGQQNQTSRKMQVYLSSSDLLTNSNTILKGAEDNGVGFILESNGSPVTLLNITNSSKGYTNLKEVAAKSKLTDTTVSIPITASYYVYDTNKVKSGALEATALINVKYD

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
biological_process GO:0007155 - cell adhesion
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
EG11987-MONOMER
ECOLIWIKI:
b2108
INTERPRO:
IPR016959
INTERPRO:
IPR036937
INTERPRO:
IPR008966
INTERPRO:
IPR000259
PFAM:
PF00419
PRIDE:
P33340
REFSEQ:
NP_416611
SMR:
P33340
UNIPROT:
P33340


Operon      
Name: yehDCBA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yehAp6 2188472 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB