RegulonDB RegulonDB 10.8: Gene Form
   

yehC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehB yehC yehD yehAp6 yehAp6

Gene      
Name: yehC    Texpresso search in the literature
Synonym(s): ECK2103, EG11989, b2110
Genome position(nucleotides): 2190926 <-- 2191645 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
39.31
External database links:  
ASAP:
ABE-0006978
ECHOBASE:
EB1932
OU-MICROARRAY:
b2110
PortEco:
yehC
STRING:
511145.b2110
COLOMBOS: yehC


Product      
Name: putative fimbrial chaperone YehC
Synonym(s): YehC
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 26.589
Isoelectric point: 10.335
Motif(s):
 
Type Positions Sequence
34 -> 156 GIVIYGTRIIYPAENKEVMVQLMNQGNRSSLLQAWIDDGDTSLPPEKIQVPFMLTPPVAKIGANSGQQVKIKIMPNKLPTNKESIFYLNVLDIPPNSPEQEGKNALKFAMQNRIKLFYRPAGI
32 -> 239 HAGIVIYGTRIIYPAENKEVMVQLMNQGNRSSLLQAWIDDGDTSLPPEKIQVPFMLTPPVAKIGANSGQQVKIKIMPNKLPTNKESIFYLNVLDIPPNSPEQEGKNALKFAMQNRIKLFYRPAGIAPVNKATFKKLLVNRSGNGLVIKNDSANWVTISDVKANNVKVNYETIMIAPLESQSVNVKSNNANNWHLTIIDDHGNYISDKI
178 -> 234 IKNDSANWVTISDVKANNVKVNYETIMIAPLESQSVNVKSNNANNWHLTIIDDHGNY
1 -> 31 MAAIPWRPFNLRGIKMKGLLSLLIFSMVLPA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0006457 - protein folding
GO:0043711 - pilus organization
GO:0071555 - cell wall organization
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
[4] Zhai Y., et al., 2002
External database links:  
ECOCYC:
EG11989-MONOMER
ECOLIWIKI:
b2110
INTERPRO:
IPR016147
INTERPRO:
IPR036316
INTERPRO:
IPR018046
INTERPRO:
IPR016148
INTERPRO:
IPR013783
INTERPRO:
IPR008962
INTERPRO:
IPR001829
MODBASE:
P33342
PFAM:
PF02753
PFAM:
PF00345
PRIDE:
P33342
PRINTS:
PR00969
PROSITE:
PS00635
REFSEQ:
NP_416613
SMR:
P33342
UNIPROT:
P33342


Operon      
Name: yehDCBA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yehAp6 2188472 reverse Similarity to the consensus
Read more >
[ICWHO] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Zhai Y., Saier MH., 2002, The beta-barrel finder (BBF) program, allowing identification of outer membrane beta-barrel proteins encoded within prokaryotic genomes., Protein Sci 11(9):2196-207

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB