RegulonDB RegulonDB 10.8: Gene Form
   

yehE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mrp yehD yehE anti-anti-terminator anti-terminator terminator metGp2 metGp2 yehEp1 yehEp1 yehEp8 yehEp8 yehEp7 yehEp7 TSS_2437 TSS_2437 TSS_2436 TSS_2436

Gene      
Name: yehE    Texpresso search in the literature
Synonym(s): ECK2105, EG11991, b2112
Genome position(nucleotides): 2192515 <-- 2192796 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.97
External database links:  
ASAP:
ABE-0006984
ECHOBASE:
EB1934
OU-MICROARRAY:
b2112
PortEco:
yehE
STRING:
511145.b2112
COLOMBOS: yehE


Product      
Name: DUF2574 domain-containing protein YehE
Synonym(s): YehE
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 10.137
Isoelectric point: 9.209
Motif(s):
 
Type Positions Sequence
1 -> 93 MNKYWLSGIIFLAYGLASPAFSSETATLAINGRISPPTCSMAMVNGQPQQHCGQLTYNVDTRHLFSSPVKGVTTEVVVAGSDSKRRIVLNRYD
23 -> 93 SETATLAINGRISPPTCSMAMVNGQPQQHCGQLTYNVDTRHLFSSPVKGVTTEVVVAGSDSKRRIVLNRYD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
EG11991-MONOMER
ECOLIWIKI:
b2112
INTERPRO:
IPR020386
PFAM:
PF10836
PRIDE:
P33344
PRODOM:
PD064930
REFSEQ:
NP_416615
UNIPROT:
P33344


Operon      
Name: yehE         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2436 2192274 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2437 2192686 forward nd [RS-EPT-CBR] [2]
  promoter yehEp7 2192880 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yehEp8 2192901 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yehEp1 2192909 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB