RegulonDB RegulonDB 10.6.3: Gene Form
   

yehF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehI yehH metG yehF LexA RcsB yehKp1 yehKp1 yehFp yehFp

Gene      
Name: yehF    Texpresso search in the literature
Synonym(s): ECK2108, EG11992, b2115, dinO, molR_1, sosF
Genome position(nucleotides): 2196474 --> 2197298 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.82
External database links:  
ASAP:
ABE-0006997
CGSC:
32567
ECOCYC:
EG11992
ECOLIHUB:
molR_1
OU-MICROARRAY:
b2115
REGULONDB:
b2115
M3D: yehF
COLOMBOS: yehF
PortEco: b2115


Product      
Name: putative protein YehF
Synonym(s): DinO, MolR_1, SosF, YehF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 30.613
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
7 -> 69 QDEKSHKFRAVEQQGNELHISWGKVGTKGQSQIKSFSDAAAAAKAELKLIAEKVKKGYVEQAK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Lee JH., et al., 1990
External database links:  
ECOCYC:
EG11992-MONOMER
ECOLIWIKI:
b2115
PFAM:
PF05406
UNIPROT:
P33345


Operon      
Name: yehF         
Operon arrangement:
Transcription unit        Promoter
yehF


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yehKp1 2203784 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Lee JH., Wendt JC., Shanmugam KT., 1990, Identification of a new gene, molR, essential for utilization of molybdate by Escherichia coli., J Bacteriol 172(4):2079-87

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB