RegulonDB RegulonDB 10.8: Gene Form
   

yehP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehM yehQ yehP yehL yehR

Gene      
Name: yehP    Texpresso search in the literature
Synonym(s): ECK2113, EG12002, b2121
Genome position(nucleotides): 2207967 --> 2209103 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.35
External database links:  
ASAP:
ABE-0007013
ECHOBASE:
EB1940
OU-MICROARRAY:
b2121
PortEco:
yehP
STRING:
511145.b2121
COLOMBOS: yehP


Product      
Name: VWA domain-containing protein YehP
Synonym(s): YehP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 42.119
Isoelectric point: 6.351
Motif(s):
 
Type Positions Sequence
151 -> 372 LAKEVRQAFSGVRDRRRRSFIPLARNFDFKSTLRANLQHWHPQHGKLYIESPRFNSRIKRQSEQWQLVLLVDQSGSMVDSVIHSAVMAACLWQLPGIRTHLVAFDTSVVDLTADVADPVELLMKVQLGGGTNIASAVEYGRQLIEQPAKSVIILVSDFYEGGSSSLLTHQVKKCVQSGIKVLGLAALDSTATPCYDRDTAQALVNVGAQIAAMTPGELASWL

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
biological_process GO:0071978 - bacterial-type flagellum-dependent swarming motility
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12002-MONOMER
ECOLIWIKI:
b2121
INTERPRO:
IPR036465
INTERPRO:
IPR002035
INTERPRO:
IPR008912
MODBASE:
P33352
PFAM:
PF05762
PRIDE:
P33352
REFSEQ:
NP_416625
SMART:
SM00327
SMR:
P33352
UNIPROT:
P33352


Operon      
Name: yehLMPQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB