RegulonDB RegulonDB 10.8: Gene Form
   

yehQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehM yehQ yehP yehR

Gene      
Name: yehQ    Texpresso search in the literature
Synonym(s): ECK2114, EG12003, b2122
Genome position(nucleotides): 2209100 --> 2210944 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.85
External database links:  
ASAP:
ABE-0007015
ECHOBASE:
EB1941
OU-MICROARRAY:
b2122
PortEco:
yehQ
STRING:
316407.85675235
COLOMBOS: yehQ


Product      
Name: SWIM zinc finger domains-containing protein YehQ
Synonym(s): YehQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 67.73
Isoelectric point: 6.16
Motif(s):
 
Type Positions Sequence
55 -> 89 VRTQLANGQALKEAQCSCGANGMCRHRVMLVLSYQ
64 -> 88 ALKEAQCSCGANGMCRHRVMLVLSY
159 -> 183 SSIRFARCDCIEGTLCEHVVLAVQA
151 -> 185 SDVRFYSRSSIRFARCDCIEGTLCEHVVLAVQAFV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0008270 - zinc ion binding
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11905N
ECOCYC:
EG12003-MONOMER
ECOLIWIKI:
b2122
INTERPRO:
IPR007527
MINT:
MINT-1308029
PFAM:
PF04434
PRIDE:
P33353
PROSITE:
PS50966
REFSEQ:
NP_416626
UNIPROT:
P33353


Operon      
Name: yehLMPQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB