RegulonDB RegulonDB 10.8: Gene Form
   

yehR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehQ yehS yehR yehP

Gene      
Name: yehR    Texpresso search in the literature
Synonym(s): ECK2115, EG12004, b2123
Genome position(nucleotides): 2211225 --> 2211686 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.42
External database links:  
ASAP:
ABE-0007018
ECHOBASE:
EB1942
OU-MICROARRAY:
b2123
PortEco:
yehR
STRING:
511145.b2123
COLOMBOS: yehR


Product      
Name: DUF1307 domain-containing lipoprotein YehR
Synonym(s): YehR
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 16.594
Isoelectric point: 8.39
Motif(s):
 
Type Positions Sequence
1 -> 22 MKAFNKLFSLVVASVLVFSLAG
28 -> 150 ESKKFSANLNGTEIAITYVYKGDKVLKQSSETKIQFASIGATTKEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENVTIDMEKVDFKALQGISGINVSAEDAKKGITMAQMELVMKAAGFK
23 -> 153 CGDKEESKKFSANLNGTEIAITYVYKGDKVLKQSSETKIQFASIGATTKEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENVTIDMEKVDFKALQGISGINVSAEDAKKGITMAQMELVMKAAGFKEVK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12004-MONOMER
ECOLIWIKI:
b2123
INTERPRO:
IPR009736
INTERPRO:
IPR036699
PDB:
2JOE
PFAM:
PF06998
PRIDE:
P33354
PROSITE:
PS51257
REFSEQ:
NP_416627
SMR:
P33354
UNIPROT:
P33354


Operon      
Name: yehR         
Operon arrangement:
Transcription unit        Promoter
yehR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB