RegulonDB RegulonDB 10.8: Gene Form
   

yehS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

btsR yehS yehR btsS

Gene      
Name: yehS    Texpresso search in the literature
Synonym(s): ECK2116, EG12005, b2124
Genome position(nucleotides): 2211726 <-- 2212196 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.04
External database links:  
ASAP:
ABE-0007021
ECHOBASE:
EB1943
OU-MICROARRAY:
b2124
PortEco:
yehS
STRING:
511145.b2124
COLOMBOS: yehS


Product      
Name: DUF1456 domain-containing protein YehS
Synonym(s): YehS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.973
Isoelectric point: 9.575
Motif(s):
 
Type Positions Sequence
86 -> 150 NNIVLKKLRIAFSLKTDDILAILTEQQFRVSMPEITAMMRAPDHKNFRECGDQFLRYFLRGLAAR
4 -> 70 NDILRSVRYILKANNNDLVRILALGNVEATAEQIAVWLRKEDEEGFQRCPDIVLSSFLNGLIYEKRG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG12005-MONOMER
ECOLIWIKI:
b2124
INTERPRO:
IPR009921
PFAM:
PF07308
PRIDE:
P33355
REFSEQ:
NP_416628
SMR:
P33355
UNIPROT:
P33355


Operon      
Name: yehS         
Operon arrangement:
Transcription unit        Promoter
yehS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB