RegulonDB RegulonDB 10.6.3: Gene Form
   

mlrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

btsS mlrA yohO yehW btsR FliZ yohOp6 yohOp6 mlrAp mlrAp mlrAp9 mlrAp9 mlrAp6 mlrAp6 TSS_2443 TSS_2443 TSS_2442 TSS_2442

Gene      
Name: mlrA    Texpresso search in the literature
Synonym(s): ECK2119, EG12008, b2127, yehV
Genome position(nucleotides): 2214866 --> 2215597 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.87
Reference(s): [1] Brown PK., et al., 2001
External database links:  
ASAP:
ABE-0007030
ECHOBASE:
EB1946
ECOCYC:
EG12008
ECOLIHUB:
mlrA
OU-MICROARRAY:
b2127
REGULONDB:
b2127
STRING:
511145.b2127
M3D: mlrA
COLOMBOS: mlrA
PortEco: b2127


Product      
Name: DNA-binding transcriptional activator MlrA
Synonym(s): MlrA, YehV
Sequence: Get amino acid sequence Fasta Format
Regulator Family: MerR
Cellular location: cytosol
Molecular weight: 28.046
Isoelectric point: 8.931
Motif(s):
 
Type Positions Sequence
4 -> 72 YTIGEVALLCDINPVTLRAWQRRYGLLKPQRTDGGHRLFNDADIDRIREIKRWIDNGVQVSKVKMLLSN
3 -> 72 LYTIGEVALLCDINPVTLRAWQRRYGLLKPQRTDGGHRLFNDADIDRIREIKRWIDNGVQVSKVKMLLSN
6 -> 25 IGEVALLCDINPVTLRAWQR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[APPHINH] Assay of protein purified to homogeneity from its native host
[IEP] Inferred from expression pattern
[IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Brown PK., et al., 2001
[2] Ogasawara H., et al., 2010
[3] Perez-Rueda E., et al., 2004
[4] Shaikh N., et al., 2003
External database links:  
ECOCYC:
EG12008-MONOMER
ECOLIWIKI:
b2127
INTERPRO:
IPR000551
INTERPRO:
IPR009061
MINT:
P33358
MODBASE:
P33358
PFAM:
PF13411
PRIDE:
P33358
PRODB:
PRO_000023244
PROSITE:
PS00552
PROSITE:
PS50937
PROTEINMODELPORTAL:
P33358
REFSEQ:
NP_416631
SMART:
SM00422
SMR:
P33358
UNIPROT:
P33358


Operon      
Name: mlrA         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Repressed by: FliZ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2442 2212969 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2443 2214673 reverse nd [RS-EPT-CBR] [5]
  promoter mlrAp6 2214749 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter mlrAp9 2214785 forward Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter yohOp6 2215586 forward Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Brown PK., Dozois CM., Nickerson CA., Zuppardo A., Terlonge J., Curtiss R., 2001, MlrA, a novel regulator of curli (AgF) and extracellular matrix synthesis by Escherichia coli and Salmonella enterica serovar Typhimurium., Mol Microbiol 41(2):349-63

 [2] Ogasawara H., Yamamoto K., Ishihama A., 2010, Regulatory role of MlrA in transcription activation of csgD, the master regulator of biofilm formation in Escherichia coli., FEMS Microbiol Lett 312(2):160-8

 [3] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [4] Shaikh N., Tarr PI., 2003, Escherichia coli O157:H7 Shiga toxin-encoding bacteriophages: integrations, excisions, truncations, and evolutionary implications., J Bacteriol 185(12):3596-605

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB