RegulonDB RegulonDB 10.8: Gene Form
   

yehW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yehX yehW mlrA yohO yehY yohOp6 yohOp6

Gene      
Name: yehW    Texpresso search in the literature
Synonym(s): ECK2121, EG12009, b2128
Genome position(nucleotides): 2215745 <-- 2216476 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.51
External database links:  
ASAP:
ABE-0007032
ECHOBASE:
EB1947
OU-MICROARRAY:
b2128
PortEco:
yehW
STRING:
511145.b2128
COLOMBOS: yehW


Product      
Name: glycine betaine ABC transporter membrane subunit YehW
Synonym(s): YehW
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 25.514
Isoelectric point: 10.438
Motif(s):
 
Type Positions Sequence
124 -> 144 YGVLPVLQATLAGLGAIDASV
68 -> 238 GTGAGIAVTRPWGAEFRPLVETIAAVGQTFPPVAVLAIAVPVIGFGLQPAIIALILYGVLPVLQATLAGLGAIDASVTEVAKGMGMSRGQRVRKVELPLAAPVILAGVRTSVIINIGTATIASTVGASTLGTPIIIGLSGFNTAYVIQGALLVALAAIIADRLFERLVQAL
207 -> 227 GFNTAYVIQGALLVALAAIIA
9 -> 29 FWLIALFVALIFWLPYSQPLF
162 -> 182 VELPLAAPVILAGVRTSVIIN

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
biological_process GO:0006865 - amino acid transport
GO:0055085 - transmembrane transport
GO:0031460 - glycine betaine transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YEHW-MONOMER
ECOLIWIKI:
b2128
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P33359
PROSITE:
PS50928
REFSEQ:
NP_416632
SMR:
P33359
UNIPROT:
P33359


Operon      
Name: osmF-yehYXW         
Operon arrangement:
Transcription unit        Promoter
osmF-yehYXW
osmF-yehYXW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yohOp6 2215586 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB