RegulonDB RegulonDB 10.9: Gene Form
   

osmF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bglX yehY osmF yehX TSS_2447 TSS_2447 TSS_2446 (cluster) TSS_2446 (cluster) TSS_2445 TSS_2445 osmFp osmFp

Gene      
Name: osmF    Texpresso search in the literature
Synonym(s): ECK2124, EG12012, b2131, yehZ
Genome position(nucleotides): 2218564 <-- 2219481 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.03
External database links:  
ASAP:
ABE-0007040
ECHOBASE:
EB1950
ECOLIHUB:
osmF
OU-MICROARRAY:
b2131
COLOMBOS: osmF


Shine dalgarno      
Sequence: gtaaaagaatGAGGAAagcatCAT


Product      
Name: glycine betaine ABC transporter periplasmic binding protein OsmF
Synonym(s): OsmF, YehZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 32.609
Isoelectric point: 5.893
Motif(s):
 
Type Positions Sequence
1 -> 23 MPLLKLWAGSLVMLAAVSLPLQA
26 -> 300 PVKVGSKIDTEGALLGNIILQVLESHGVPTVNKVQLGTTPVVRGAITSGELDIYPEYTGNGAFFFKDENDAAWKNAQQGYEKVKKLDSEHNKLIWLTPAPANNTWTIAVRQDVAEKNKLTSLADLSRYLQEGGTFKLAASAEFIERADALPAFEKAYGFKLGQDQLLSLAGGDTAVTIKAAAQQTSGVNAAMAYGTDGPVAALGLQTLSDPQGVQPIYAPAPVVRESVLREYPQMAQWLQPVFASLDAKTLQQLNASIAVEGLDAKKVAADYLKQ
241 -> 305 PIYAPAPVVRESVLREYPQMAQWLQPVFASLDAKTLQQLNASIAVEGLDAKKVAADYLKQKGWTK
24 -> 305 ASPVKVGSKIDTEGALLGNIILQVLESHGVPTVNKVQLGTTPVVRGAITSGELDIYPEYTGNGAFFFKDENDAAWKNAQQGYEKVKKLDSEHNKLIWLTPAPANNTWTIAVRQDVAEKNKLTSLADLSRYLQEGGTFKLAASAEFIERADALPAFEKAYGFKLGQDQLLSLAGGDTAVTIKAAAQQTSGVNAAMAYGTDGPVAALGLQTLSDPQGVQPIYAPAPVVRESVLREYPQMAQWLQPVFASLDAKTLQQLNASIAVEGLDAKKVAADYLKQKGWTK
25 -> 128 SPVKVGSKIDTEGALLGNIILQVLESHGVPTVNKVQLGTTPVVRGAITSGELDIYPEYTGNGAFFFKDENDAAWKNAQQGYEKVKKLDSEHNKLIWLTPAPANN

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0006865 - amino acid transport
GO:0055085 - transmembrane transport
GO:0071474 - cellular hyperosmotic response
GO:0031460 - glycine betaine transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
YEHZ-MONOMER
ECOLIWIKI:
b2131
INTERPRO:
IPR007210
MODBASE:
P33362
PDB:
4WEP
PFAM:
PF04069
PRIDE:
P33362
REFSEQ:
NP_416635
SMR:
P33362
UNIPROT:
P33362


Operon      
Name: osmF-yehYXW         
Operon arrangement:
Transcription unit        Promoter
osmF-yehYXW
osmF-yehYXW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2445 2220276 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2446 (cluster) 2220896 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2447 2220929 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB