RegulonDB RegulonDB 10.8: Gene Form
   

bglX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bglX dld osmF TSS_2451 TSS_2451 TSS_2450 TSS_2450 dldp6 dldp6 bglXp bglXp dldp7 dldp7 TSS_2448 TSS_2448 TSS_2447 TSS_2447 TSS_2446 (cluster) TSS_2446 (cluster) TSS_2445 TSS_2445 osmFp osmFp

Gene      
Name: bglX    Texpresso search in the literature
Synonym(s): ECK2125, EG12013, b2132, glh, yohA
Genome position(nucleotides): 2219692 <-- 2221989 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.22
External database links:  
ASAP:
ABE-0007043
ECHOBASE:
EB1951
OU-MICROARRAY:
b2132
PortEco:
bglX
STRING:
511145.b2132
COLOMBOS: bglX


Product      
Name: β-D-glucoside glucohydrolase, periplasmic
Synonym(s): BglX, Glh, YohA
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 83.46
Isoelectric point: 6.084
Motif(s):
 
Type Positions Sequence
21 -> 765 DDLFGNHPLTPEARDAFVTELLKKMTVDEKIGQLRLISVGPDNPKEAIREMIKDGQVGAIFNTVTRQDIRAMQDQVMELSRLKIPLFFAYDVLHGQRTVFPISLGLASSFNLDAVKTVGRVSAYEAADDGLNMTWAPMVDVSRDPRWGRASEGFGEDTYLTSTMGKTMVEAMQGKSPADRYSVMTSVKHFAAYGAVEGGKEYNTVDMSPQRLFNDYMPPYKAGLDAGSGAVMVALNSLNGTPATSDSWLLKDVLRDQWGFKGITVSDHGAIKELIKHGTAADPEDAVRVALKSGINMSMSDEYYSKYLPGLIKSGKVTMAELDDAARHVLNVKYDMGLFNDPYSHLGPKESDPVDTNAESRLHRKEAREVARESLVLLKNRLETLPLKKSATIAVVGPLADSKRDVMGSWSAAGVADQSVTVLTGIKNAVGENGKVLYAKGANVTSDKGIIDFLNQYEEAVKVDPRSPQEMIDEAVQTAKQSDVVVAVVGEAQGMAHEASSRTDITIPQSQRDLIAALKATGKPLVLVLMNGRPLALVKEDQQADAILETWFAGTEGGNAIADVLFGDYNPSGKLPMSFPRSVGQIPVYYSHLNTGRPYNADKPNKYTSRYFDEANGALYPFGYGLSYTTFTVSDVKLSAPTMKRDGKVTASVQVTNTGKREGATVVQMYLQDVTASMSRPVKQLKGFEKITLKPGETQTVSFPIDIEALKFWNQQMKYDAEPGKFNVFIGTDSARVKKGEFELL
1 -> 20 MKWLCSVGIAVSLALQPALA
395 -> 648 LVLLKNRLETLPLKKSATIAVVGPLADSKRDVMGSWSAAGVADQSVTVLTGIKNAVGENGKVLYAKGANVTSDKGIIDFLNQYEEAVKVDPRSPQEMIDEAVQTAKQSDVVVAVVGEAQGMAHEASSRTDITIPQSQRDLIAALKATGKPLVLVLMNGRPLALVKEDQQADAILETWFAGTEGGNAIADVLFGDYNPSGKLPMSFPRSVGQIPVYYSHLNTGRPYNADKPNKYTSRYFDEANGALYPFGYGLSY
46 -> 352 TVDEKIGQLRLISVGPDNPKEAIREMIKDGQVGAIFNTVTRQDIRAMQDQVMELSRLKIPLFFAYDVLHGQRTVFPISLGLASSFNLDAVKTVGRVSAYEAADDGLNMTWAPMVDVSRDPRWGRASEGFGEDTYLTSTMGKTMVEAMQGKSPADRYSVMTSVKHFAAYGAVEGGKEYNTVDMSPQRLFNDYMPPYKAGLDAGSGAVMVALNSLNGTPATSDSWLLKDVLRDQWGFKGITVSDHGAIKELIKHGTAADPEDAVRVALKSGINMSMSDEYYSKYLPGLIKSGKVTMAELDDAARHVLNV
686 -> 754 VVQMYLQDVTASMSRPVKQLKGFEKITLKPGETQTVSFPIDIEALKFWNQQMKYDAEPGKFNVFIGTDS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016787 - hydrolase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0015926 - glucosidase activity
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0008422 - beta-glucosidase activity
GO:0102483 - scopolin beta-glucosidase activity
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0009251 - glucan catabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH3
DIP:
DIP-9218N
ECOCYC:
EG12013-MONOMER
ECOLIWIKI:
b2132
INTERPRO:
IPR013783
INTERPRO:
IPR036962
INTERPRO:
IPR036881
INTERPRO:
IPR026891
INTERPRO:
IPR019800
INTERPRO:
IPR017853
INTERPRO:
IPR002772
INTERPRO:
IPR001764
MODBASE:
P33363
PANTHER:
PTHR30620
PFAM:
PF00933
PFAM:
PF01915
PFAM:
PF14310
PRIDE:
P33363
PRINTS:
PR00133
PRODB:
PRO_000022219
PROSITE:
PS00775
REFSEQ:
NP_416636
SMART:
SM01217
SMR:
P33363
UNIPROT:
P33363


Operon      
Name: bglX         
Operon arrangement:
Transcription unit        Promoter
bglX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2445 2220276 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2446 (cluster) 2220896 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2447 2220929 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2448 2222042 reverse nd [RS-EPT-CBR] [1]
  promoter dldp7 2222082 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter dldp6 2222152 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter TSS_2450 2222154 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2451 2223795 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB