RegulonDB RegulonDB 10.8: Gene Form
   

yeiI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nupX yeiI nfo yeiIp2 yeiIp2

Gene      
Name: yeiI    Texpresso search in the literature
Synonym(s): ECK2153, EG12028, b2160
Genome position(nucleotides): 2251700 --> 2252788 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.79
External database links:  
ASAP:
ABE-0007149
ECHOBASE:
EB1963
OU-MICROARRAY:
b2160
PortEco:
yeiI
STRING:
511145.b2160
COLOMBOS: yeiI


Product      
Name: putative sugar kinase YeiI
Synonym(s): YeiI
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.71
Isoelectric point: 5.703
Motif(s):
 
Type Positions Sequence
1 -> 48 MNNREKEILAILRRNPLIQQNEIADMLQISRSRVAAHIMDLMRKGRIK
58 -> 348 EYCVVVGTINMDIRGMADIRYPQSASHPGTIHCSAGGVGRNIAHNLALLGRDVHLLSVIGDDFYGEMLLEETRRAGVNVSGCVRLHGQSTSTYLAIANRDDQTVLAINDTHLLEQLTPQLLNGSRDLLRHAGVVLADCNLTAEALEWVFTLADEIPVFVDTVSEFKAGKIKHWLAHIHTLKPTLPELEILWGQAITSDADRNTAVNALHQQGVQQLFVYLPDESVYCSEKDGEQFLLTAPAHTTVDSFGADDGFMAGLVYSFLEGYSFRDSARFAVACAAISRASGSLNNP
335 -> 362 CAAISRASGSLNNPTLSADNALSLVPMV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0019200 - carbohydrate kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
biological_process GO:0016310 - phosphorylation
GO:0046835 - carbohydrate phosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11921N
ECOCYC:
EG12028-MONOMER
ECOLIWIKI:
b2160
INTERPRO:
IPR011611
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR029056
INTERPRO:
IPR002173
MODBASE:
P33020
PFAM:
PF00294
PRIDE:
P33020
PROSITE:
PS00583
PROSITE:
PS00584
REFSEQ:
NP_416665
SMR:
P33020
UNIPROT:
P33020


Operon      
Name: yeiI         
Operon arrangement:
Transcription unit        Promoter
yeiI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeiIp2 2251653 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB