RegulonDB RegulonDB 10.7: Gene Form
   

yeiL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

psuT rihB yeiL FNR Lrp IHF IHF yeiLp yeiLp rihBp rihBp

Gene      
Name: yeiL    Texpresso search in the literature
Synonym(s): ECK2156, EG12031, b2163
Genome position(nucleotides): 2255355 --> 2256014 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.0
External database links:  
ASAP:
ABE-0007160
ECHOBASE:
EB1966
OU-MICROARRAY:
b2163
PORTECO:
yeiL
REGULONDB:
b2163
STRING:
511145.b2163
M3D: yeiL
COLOMBOS: yeiL
PortEco: b2163


Product      
Name: putative DNA-binding transcriptional regulator YeiL
Synonym(s): YeiL
Sequence: Get amino acid sequence Fasta Format
Regulator Family: Cyclic nucleotide_binding domain
Cellular location: cytosol
Molecular weight: 25.294
Isoelectric point: 8.214
Motif(s):
 
Type Positions Sequence
158 -> 181 KHTQAAEYLGVSYRHLLYVLAQFI
19 -> 97 RLFHFLARDYIVQEGQQPSWLFYLTRGRARLYATLANGRVSLIDFFAAPCFIGEIELIDKDHEPRAVQAIEECWCLALP
136 -> 199 FPLVNRLAAFILLSQEGDLYHEKHTQAAEYLGVSYRHLLYVLAQFIHDGLLIKSKKGYLIKNRK
22 -> 105 HFLARDYIVQEGQQPSWLFYLTRGRARLYATLANGRVSLIDFFAAPCFIGEIELIDKDHEPRAVQAIEECWCLALPMKHYRPLL
111 -> 131 FLRKLCVTLSHKNYRNIVSLT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
GO:0003700 - DNA-binding transcription factor activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [GEA] Gene expression analysis
[HIFS] Human inference of function from sequence
Reference(s): [1] Anjum MF., et al., 2000
[2] Blattner FR., et al., 1997
External database links:  
ECOCYC:
EG12031-MONOMER
ECOLIWIKI:
b2163
INTERPRO:
IPR012318
INTERPRO:
IPR018490
INTERPRO:
IPR000595
MODBASE:
P0A9E9
PFAM:
PF00027
PRIDE:
P0A9E9
PRODB:
PRO_000023417
PROSITE:
PS51063
PROSITE:
PS50042
PROTEINMODELPORTAL:
P0A9E9
REFSEQ:
NP_416668
SMART:
SM00100
SMR:
P0A9E9
UNIPROT:
P0A9E9


Operon      
Name: yeiL         
Operon arrangement:
Transcription unit        Promoter
yeiL
yeiL


Transcriptional Regulation      
Display Regulation             
Activated by: IHF, Lrp, YeiL
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Anjum MF., Green J., Guest JR., 2000, YeiL, the third member of the CRP-FNR family in Escherichia coli., Microbiology 146 Pt 12:3157-70

 [2] Blattner FR., Plunkett G., Bloch CA., Perna NT., Burland V., Riley M., Collado-Vides J., Glasner JD., Rode CK., Mayhew GF., Gregor J., Davis NW., Kirkpatrick HA., Goeden MA., Rose DJ., Mau B., Shao Y., 1997, The complete genome sequence of Escherichia coli K-12., Science 277(5331):1453-74


RegulonDB