RegulonDB RegulonDB 10.8: Gene Form
   

yejB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yejA yejB yejE yejG5\' yejF TSS_2476 TSS_2476 TSS_2475 TSS_2475

Gene      
Name: yejB    Texpresso search in the literature
Synonym(s): ECK2172, EG12038, b2178
Genome position(nucleotides): 2274179 --> 2275273 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.23
External database links:  
ASAP:
ABE-0007208
ECHOBASE:
EB1973
OU-MICROARRAY:
b2178
PortEco:
yejB
STRING:
511145.b2178
COLOMBOS: yejB


Product      
Name: putative oligopeptide ABC transporter membrane subunit YejB
Synonym(s): YejB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 40.36
Isoelectric point: 8.595
Motif(s):
 
Type Positions Sequence
133 -> 348 LPVSITLGLWSTLIIYLVSIPLGIRKAVYNGSRFDVWSSAFIIIGYAIPAFLFAILLIVFFAGGSYFDLFPLRGLVSANFDSLPWYQKITDYLWHITLPVLATVIGGFAALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPATFISMFFTGSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNIVS
285 -> 305 LVIAGFPATFISMFFTGSLLI
152 -> 359 IPLGIRKAVYNGSRFDVWSSAFIIIGYAIPAFLFAILLIVFFAGGSYFDLFPLRGLVSANFDSLPWYQKITDYLWHITLPVLATVIGGFAALTMLTKNSFLDEVRKQYVVTARAKGVSEKNILWKHVFRNAMLLVIAGFPATFISMFFTGSLLIEVMFSLNGLGLLGYEATVSRDYPVMFGTLYIFTLIGLLLNIVSDISYTLVDPRI
327 -> 347 YPVMFGTLYIFTLIGLLLNIV
9 -> 29 LLLVIPTLWAIITINFFIVQI

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
biological_process GO:0042884 - microcin transport
GO:0055085 - transmembrane transport
GO:0035672 - oligopeptide transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
ECOCYC:
YEJB-MONOMER
ECOLIWIKI:
b2178
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P0AFU0
PROSITE:
PS50928
REFSEQ:
NP_416683
UNIPROT:
P0AFU0


Operon      
Name: yejABEF         
Operon arrangement:
Transcription unit        Promoter
 


Regulation by small RNA    
  Display Regulation
small RNA rydC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2475 2272388 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2476 2273514 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB